Protein Family IF07670
Metagenome
Isolate
113
Members
50
Samples
101
Scaffolds
264.52
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_133212|Ga0466715_133212_639_1670
- Length
- 315 aa
- Sequence
- VLSAGNFVKNISHSGNCQDKSKKLIIGWFKLRSKHFRCKIAVYALLYLYLEDVALTELKYKFTYDTLFKLLFVKYPDLLKWFVAAVLGIAVDSITEFKITNPEIPPEALGDKFCRLDVNMAVDGIRVNLEVQVENEGDYPERSLYHWARVYSSALPVGRTYSELPRVIIISIIDESVFDCEEYHSEFQPLEVTRRVPLTDRMVLHYFEVRKLPKDVDVKNELQLMLSLFRAKTEEELKQLERSGVPIVTQAVGAYREVTVSPEFKELERLRTLARHNEASALCNARRKESEKWQKVVEKKDAALADSNAALGGDR
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
24.0%
Unclassified
18.0%
Termopsidae
4.0%
Hodotermitidae
2.0%
Rhinotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 17 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 23 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 43 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 44 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10018566 | 3300002450 | Bacteria | 3471 |
| 2 | Ga0123355_10514524 | 3300009826 | Bacteria | 1468 |
| 3 | Ga0123356_10470555 | 3300010049 | Bacteria | 1408 |
| 4 | Ga0123353_10456319 | 3300010167 | Bacteria | 1880 |
| 5 | Ga0123353_10992309 | 3300010167 | Bacteria | 1129 |
| 6 | Ga0466705_507031 | 3300042612 | Bacteria | 32671 |
| 7 | Ga0466723_096965 | 3300042618 | Bacteria | 1685 |
| 8 | Ga0415639_026308 | 3300038395 | Bacteria | 4916 |
| 9 | Ga0466693_171041 | 3300042592 | Bacteria | 1102 |
| 10 | Ga0466693_301630 | 3300042592 | Bacteria | 4875 |
| 11 | Ga0466699_379045 | 3300042597 | Bacteria | 1957 |
| 12 | JGI24698J34947_10063627 | 3300002449 | Unclassified | 1807 |
| 13 | JGI24695J34938_10014882 | 3300002450 | Bacteria | 4011 |
| 14 | JGI24702J35022_10021512 | 3300002462 | Bacteria | 3497 |
| 15 | Ga0123357_10452899 | 3300009784 | Bacteria | 1111 |
| 16 | Ga0466735_015105 | 3300042624 | Bacteria | 2405 |
| 17 | Ga0466702_294490 | 3300042635 | Bacteria | 1585 |
| 18 | Ga0466703_061780 | 3300042636 | Bacteria | 2092 |
| 19 | Ga0466709_228847 | 3300042648 | Bacteria | 1395 |
| 20 | Ga0466691_182421 | 3300042593 | Bacteria | 1312 |
| 21 | Ga0466699_107037 | 3300042597 | Bacteria | 9332 |
| 22 | Ga0466699_146437 | 3300042597 | Bacteria | 1189 |
| 23 | Ga0466706_089961 | 3300042599 | Bacteria | 4792 |
| 24 | Ga0072940_1216541 | 3300005200 | Bacteria | 943 |
| 25 | Ga0123355_10571205 | 3300009826 | Bacteria | 1357 |
| 26 | Ga0466705_430897 | 3300042612 | Bacteria | 1928 |
| 27 | Ga0466723_301566 | 3300042618 | Bacteria | 9270 |
| 28 | Ga0466704_105605 | 3300042643 | Bacteria | 3859 |
| 29 | Ga0466727_052404 | 3300042655 | Bacteria | 1938 |
| 30 | Ga0415639_194701 | 3300038395 | Bacteria | 1051 |
| 31 | Ga0466693_348641 | 3300042592 | Bacteria | 1011 |
| 32 | Ga0466706_135195 | 3300042599 | Bacteria | 1089 |
| 33 | Ga0466716_011432 | 3300042605 | Bacteria | 1209 |
| 34 | Ga0466719_197213 | 3300042606 | Bacteria | 8630 |
| 35 | JGI24698J34947_10008840 | 3300002449 | Bacteria | 5529 |
| 36 | JGI24695J34938_10006689 | 3300002450 | Bacteria | 6868 |
| 37 | Ga0123353_10592617 | 3300010167 | Bacteria | 1587 |
| 38 | Ga0466723_127630 | 3300042618 | Bacteria | 4698 |
| 39 | Ga0466704_326448 | 3300042643 | Bacteria | 6536 |
| 40 | Ga0466693_375992 | 3300042592 | Bacteria | 1772 |
| 41 | Ga0466691_159330 | 3300042593 | Bacteria | 3182 |
| 42 | Ga0466696_046550 | 3300042596 | Bacteria | 1106 |
| 43 | JGI24695J34938_10000110 | 3300002450 | Bacteria | 73179 |
| 44 | Ga0123353_10000566 | 3300010167 | Bacteria | 45539 |
| 45 | Ga0466718_042485 | 3300042617 | Bacteria | 21646 |
| 46 | Ga0466731_398094 | 3300042622 | Bacteria | 1892 |
| 47 | Ga0466734_060879 | 3300042623 | Bacteria | 1060 |
| 48 | Ga0466702_271134 | 3300042635 | Bacteria | 1475 |
| 49 | Ga0466704_530928 | 3300042643 | Bacteria | 5893 |
| 50 | Ga0466693_427648 | 3300042592 | Bacteria | 1005 |
| 51 | Ga0466694_281157 | 3300042594 | Bacteria | 24970 |
| 52 | Ga0466722_225489 | 3300042609 | Bacteria | 1627 |
| 53 | JGI24703J35330_11741406 | 3300002501 | Bacteria | 3544 |
| 54 | JGI24705J35276_12238180 | 3300002504 | Bacteria | 16980 |
| 55 | Ga0123357_10357781 | 3300009784 | Bacteria | 1387 |
| 56 | Ga0123355_10001197 | 3300009826 | Bacteria | 36098 |
| 57 | Ga0123355_10022136 | 3300009826 | Bacteria | 10187 |
| 58 | Ga0123355_10385641 | 3300009826 | Bacteria | 1821 |
| 59 | Ga0123353_10438036 | 3300010167 | Bacteria | 1929 |
| 60 | Ga0466715_133212 | 3300042616 | Bacteria | 15847 |
| 61 | Ga0466723_259817 | 3300042618 | Bacteria | 1653 |
| 62 | Ga0466709_000035 | 3300042648 | Bacteria | 2429 |
| 63 | Ga0466708_018325 | 3300042652 | Bacteria | 20797 |
| 64 | Ga0466725_377603 | 3300042654 | Bacteria | 1340 |
| 65 | Ga0466693_005698 | 3300042592 | Bacteria | 2150 |
| 66 | Ga0466693_217735 | 3300042592 | Bacteria | 1129 |
| 67 | Ga0466693_402579 | 3300042592 | Bacteria | 2058 |
| 68 | Ga0466713_098126 | 3300042602 | Bacteria | 19600 |
| 69 | Ga0466714_062251 | 3300042603 | Bacteria | 3230 |
| 70 | Ga0466698_369603 | 3300042610 | Bacteria | 1371 |
| 71 | Ga0123355_10358693 | 3300009826 | Bacteria | 1923 |
| 72 | Ga0123356_10770653 | 3300010049 | Bacteria | 1133 |
| 73 | Ga0123353_10864912 | 3300010167 | Bacteria | 1237 |
| 74 | Ga0123354_10059687 | 3300010882 | Bacteria | 5654 |
| 75 | Ga0466705_434012 | 3300042612 | Bacteria | 38552 |
| 76 | Ga0466702_218932 | 3300042635 | Bacteria | 1020 |
| 77 | Ga0466709_022411 | 3300042648 | Bacteria | 1735 |
| 78 | Ga0466709_051977 | 3300042648 | Bacteria | 1154 |
| 79 | Ga0415639_021617 | 3300038395 | Bacteria | 2568 |
| 80 | Ga0466693_186069 | 3300042592 | Bacteria | 1884 |
| 81 | Ga0466706_065773 | 3300042599 | Bacteria | 4531 |
| 82 | Ga0466707_170443 | 3300042601 | Bacteria | 3012 |
| 83 | Ga0466721_009302 | 3300042608 | Bacteria | 2140 |
| 84 | Ga0466705_251614 | 3300042612 | Bacteria | 43991 |
| 85 | Ga0466705_329947 | 3300042612 | Bacteria | 6768 |
| 86 | Ga0466732_413995 | 3300042656 | Bacteria | 1330 |
| 87 | Ga0123357_10162123 | 3300009784 | Bacteria | 2677 |
| 88 | Ga0123353_11196755 | 3300010167 | Bacteria | 998 |
| 89 | Ga0123354_10286933 | 3300010882 | Bacteria | 1586 |
| 90 | Ga0466705_421583 | 3300042612 | Bacteria | 20644 |
| 91 | Ga0466712_099239 | 3300042614 | Bacteria | 1747 |
| 92 | Ga0466712_179998 | 3300042614 | Bacteria | 1632 |
| 93 | Ga0466711_319117 | 3300042615 | Bacteria | 2068 |
| 94 | Ga0466731_325079 | 3300042622 | Bacteria | 1339 |
| 95 | Ga0466734_170977 | 3300042623 | Bacteria | 1614 |
| 96 | Ga0466704_046743 | 3300042643 | Bacteria | 18094 |
| 97 | Ga0466704_499182 | 3300042643 | Bacteria | 1672 |
| 98 | Ga0466704_534716 | 3300042643 | Bacteria | 1270 |
| 99 | Ga0466704_553347 | 3300042643 | Bacteria | 8474 |
| 100 | Ga0466709_347201 | 3300042648 | Bacteria | 1526 |
| 101 | Ga0466693_434039 | 3300042592 | Bacteria | 1810 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12784 | PDDEXK_2 | PD-(D/E)XK nuclease family transposase | 65 | 282 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.