Protein Family IF07640
Metagenome
Isolate
116
Members
37
Samples
111
Scaffolds
285.1
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_075770|Ga0466715_075770_3212_4126
- Length
- 304 aa
- Sequence
- VFDYHSFAPLAAAAEEAGTPVSVIVLADQARQMERSEGELFDEMRKTLEVMKAAAAGGADPLLRSPSGLSGGLSFRMKERLGKKTLSGPFCTAAIARALAVAEYNAAMGRIVAAPTAGACGILPAAVLTMLEGDLRTGGAAHTGGRPRRVTEAAAVMSLFTAGALGMVIANEACIAGAEGGCQAECGSASAMAAAALAELAGGGPAMVSHAAAIALKNQLGLVCDPVAGLVEVPCVKRNAGGIMCAIGAAEMALAGIESVIPLDEVITAMGEIGAALPATLRETAQGGLAATPTGLEIRRKIFG
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.1%
Unclassified
21.6%
Termitidae
21.6%
Termopsidae
10.8%
Rhinotermitidae
8.1%
Hodotermitidae
2.7%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 21 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_239058 | 3300042601 | Bacteria | 1424 |
| 2 | Ga0466707_251806 | 3300042601 | Bacteria | 3507 |
| 3 | Ga0466713_148447 | 3300042602 | Bacteria | 1367 |
| 4 | Ga0466722_109062 | 3300042609 | Bacteria | 4766 |
| 5 | Ga0466704_077907 | 3300042643 | Bacteria | 5345 |
| 6 | Ga0466704_248982 | 3300042643 | Bacteria | 16931 |
| 7 | Ga0466709_204731 | 3300042648 | Unclassified | 6282 |
| 8 | Ga0466691_072630 | 3300042593 | Bacteria | 2222 |
| 9 | Ga0123355_10872296 | 3300009826 | Unclassified | 985 |
| 10 | Ga0123353_10305952 | 3300010167 | Bacteria | 2423 |
| 11 | Ga0466715_115540 | 3300042616 | Unclassified | 6994 |
| 12 | Ga0466723_011294 | 3300042618 | Bacteria | 53611 |
| 13 | Ga0466723_126518 | 3300042618 | Bacteria | 19136 |
| 14 | Ga0466726_142265 | 3300042619 | Bacteria | 2114 |
| 15 | Ga0466731_328038 | 3300042622 | Bacteria | 2793 |
| 16 | Ga0466735_151174 | 3300042624 | Bacteria | 11305 |
| 17 | Ga0466703_145657 | 3300042636 | Bacteria | 1491 |
| 18 | Ga0466703_256991 | 3300042636 | Bacteria | 11991 |
| 19 | Ga0466703_316315 | 3300042636 | Bacteria | 6411 |
| 20 | Ga0466690_155072 | 3300042590 | Bacteria | 9522 |
| 21 | Ga0466690_197629 | 3300042590 | Bacteria | 4780 |
| 22 | Ga0466693_238631 | 3300042592 | Bacteria | 5736 |
| 23 | Ga0466691_011351 | 3300042593 | Bacteria | 9209 |
| 24 | Ga0123355_10006901 | 3300009826 | Bacteria | 16906 |
| 25 | Ga0123355_10447117 | 3300009826 | Bacteria | 1632 |
| 26 | Ga0466723_087757 | 3300042618 | Bacteria | 22109 |
| 27 | Ga0466723_150383 | 3300042618 | Bacteria | 7727 |
| 28 | Ga0466723_162448 | 3300042618 | Bacteria | 2026 |
| 29 | Ga0466723_322064 | 3300042618 | Bacteria | 1794 |
| 30 | Ga0466706_186077 | 3300042599 | Bacteria | 1601 |
| 31 | Ga0466707_159901 | 3300042601 | Bacteria | 20133 |
| 32 | Ga0466716_055868 | 3300042605 | Bacteria | 1480 |
| 33 | Ga0466722_015744 | 3300042609 | Bacteria | 13213 |
| 34 | Ga0466722_186510 | 3300042609 | Bacteria | 3475 |
| 35 | Ga0466729_254550 | 3300042621 | Bacteria | 3043 |
| 36 | Ga0466691_207329 | 3300042593 | Bacteria | 5395 |
| 37 | Ga0466715_272365 | 3300042616 | Bacteria | 50899 |
| 38 | Ga0466715_487341 | 3300042616 | Bacteria | 37758 |
| 39 | Ga0466726_096078 | 3300042619 | Bacteria | 6367 |
| 40 | Ga0466726_473578 | 3300042619 | Unclassified | 2309 |
| 41 | Ga0466705_099197 | 3300042612 | Bacteria | 8370 |
| 42 | Ga0466707_016956 | 3300042601 | Bacteria | 10709 |
| 43 | Ga0466707_382762 | 3300042601 | Bacteria | 2321 |
| 44 | Ga0466703_360992 | 3300042636 | Bacteria | 10288 |
| 45 | Ga0466690_102116 | 3300042590 | Bacteria | 3470 |
| 46 | Ga0123355_10050863 | 3300009826 | Bacteria | 6728 |
| 47 | Ga0123353_10291555 | 3300010167 | Bacteria | 2497 |
| 48 | Ga0466715_123280 | 3300042616 | Bacteria | 4492 |
| 49 | Ga0466726_223271 | 3300042619 | Bacteria | 1308 |
| 50 | Ga0466726_333610 | 3300042619 | Bacteria | 2662 |
| 51 | Ga0466728_207263 | 3300042620 | Bacteria | 13163 |
| 52 | Ga0466706_106526 | 3300042599 | Bacteria | 2190 |
| 53 | Ga0466707_275338 | 3300042601 | Bacteria | 1458 |
| 54 | Ga0466716_466075 | 3300042605 | Bacteria | 2805 |
| 55 | Ga0466719_147793 | 3300042606 | Bacteria | 5249 |
| 56 | Ga0466722_176094 | 3300042609 | Bacteria | 2273 |
| 57 | Ga0466729_200026 | 3300042621 | Bacteria | 1390 |
| 58 | Ga0123355_10159510 | 3300009826 | Bacteria | 3402 |
| 59 | Ga0123353_10010360 | 3300010167 | Unclassified | 12986 |
| 60 | Ga0068305_10492575 | 3300005083 | Bacteria | 12577 |
| 61 | Ga0466715_109406 | 3300042616 | Bacteria | 5322 |
| 62 | Ga0466715_147716 | 3300042616 | Bacteria | 1834 |
| 63 | Ga0466715_335413 | 3300042616 | Bacteria | 11583 |
| 64 | Ga0466723_181101 | 3300042618 | Bacteria | 3501 |
| 65 | Ga0466723_229569 | 3300042618 | Bacteria | 135891 |
| 66 | Ga0466728_235396 | 3300042620 | Bacteria | 3411 |
| 67 | Ga0466705_202204 | 3300042612 | Bacteria | 7247 |
| 68 | Ga0466727_348875 | 3300042655 | Bacteria | 3113 |
| 69 | Ga0466713_124478 | 3300042602 | Unclassified | 1791 |
| 70 | Ga0466719_488275 | 3300042606 | Bacteria | 1938 |
| 71 | Ga0466719_575710 | 3300042606 | Bacteria | 8976 |
| 72 | Ga0466722_080291 | 3300042609 | Bacteria | 6974 |
| 73 | Ga0466722_085260 | 3300042609 | Bacteria | 7573 |
| 74 | Ga0466722_094121 | 3300042609 | Bacteria | 4560 |
| 75 | Ga0466704_316404 | 3300042643 | Bacteria | 34298 |
| 76 | Ga0466692_055033 | 3300042591 | Bacteria | 24817 |
| 77 | Ga0123356_10220943 | 3300010049 | Bacteria | 1951 |
| 78 | Ga0123353_10028069 | 3300010167 | Unclassified | 8638 |
| 79 | Ga0466715_046098 | 3300042616 | Bacteria | 3770 |
| 80 | Ga0466715_559163 | 3300042616 | Bacteria | 16833 |
| 81 | Ga0466723_113916 | 3300042618 | Bacteria | 12126 |
| 82 | Ga0466723_132121 | 3300042618 | Bacteria | 12404 |
| 83 | Ga0466726_055393 | 3300042619 | Bacteria | 4849 |
| 84 | Ga0466733_189155 | 3300042659 | Bacteria | 2473 |
| 85 | Ga0466719_015336 | 3300042606 | Bacteria | 1736 |
| 86 | Ga0466719_420983 | 3300042606 | Unclassified | 2676 |
| 87 | Ga0466722_068235 | 3300042609 | Bacteria | 14587 |
| 88 | Ga0466703_068799 | 3300042636 | Bacteria | 28085 |
| 89 | Ga0466708_044211 | 3300042652 | Bacteria | 16621 |
| 90 | Ga0466727_174254 | 3300042655 | Bacteria | 3387 |
| 91 | Ga0466691_021275 | 3300042593 | Bacteria | 5943 |
| 92 | Ga0466696_007169 | 3300042596 | Bacteria | 6718 |
| 93 | Ga0466696_129745 | 3300042596 | Bacteria | 25058 |
| 94 | Ga0123353_10854003 | 3300010167 | Bacteria | 1247 |
| 95 | Ga0466715_075770 | 3300042616 | Bacteria | 4312 |
| 96 | Ga0466705_116516 | 3300042612 | Bacteria | 11566 |
| 97 | Ga0466707_328189 | 3300042601 | Bacteria | 2205 |
| 98 | Ga0466704_056398 | 3300042643 | Bacteria | 4368 |
| 99 | Ga0466708_025332 | 3300042652 | Bacteria | 7999 |
| 100 | Ga0466708_253656 | 3300042652 | Bacteria | 9770 |
| 101 | Ga0415639_235278 | 3300038395 | Bacteria | 1486 |
| 102 | Ga0466691_157688 | 3300042593 | Bacteria | 28759 |
| 103 | Ga0123357_10135961 | 3300009784 | Unclassified | 3040 |
| 104 | Ga0123355_10000701 | 3300009826 | Bacteria | 45410 |
| 105 | Ga0123355_10002508 | 3300009826 | Bacteria | 26011 |
| 106 | Ga0123355_10019724 | 3300009826 | Bacteria | 10741 |
| 107 | Ga0123353_10457361 | 3300010167 | Unclassified | 1877 |
| 108 | Ga0068302_10113268 | 3300005071 | Bacteria | 1115 |
| 109 | Ga0466723_290981 | 3300042618 | Bacteria | 2442 |
| 110 | Ga0466726_196816 | 3300042619 | Bacteria | 2409 |
| 111 | Ga0466728_060943 | 3300042620 | Bacteria | 5863 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03313 | SDH_alpha | Serine dehydratase alpha chain | 17 | 290 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.