Protein Family IF07633

Metagenome Isolate
354 Members
92 Samples
327 Scaffolds
330.11 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_065172|Ga0466715_065172_10418_11527
Length
369 aa
Sequence
MTAENRNTADHASDRAADFTSHPASGSASRALRLVKEEIAKAFIGQASLVDHALITALAGGHLLVEGVPGLGKTLLVRALARAIGGESRRVQFTPDLMPGDITGSIMLDTGSGKFITRKGPVFTNFFIADEINRAPAKTQAALFEAMQEFQVSLDGTAYPLPEPFMVLATENPFEHEGTYPLPDAQKDRFLMKVIASYPAPEEEIAMVSMVLAEDTGAMLSVDDVETVLPPGGFSALRSFAARIRTDPLVIDYAVRLCAATRNDPHAETGAGPRGSLALIRCARARALLEGRGFVLPDDVKALAVPVLAHRLTLSAESELEGLDERRIILNLVAGIEAPRLPPPVPEGEVLPPAXEEGRGAAAAGGASS

πŸ“Š Sample Types

Isolate 7.6%
Metagenome 92.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 34.5%
Unclassified 31.0%
Kalotermitidae 16.1%
Culicidae 8.0%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Armadillidiidae 1.1%
Scarabaeidae 1.1%
Alydidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 294
Eukaryota 0
Viruses 0
Unclassified 59

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
3 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
12 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
19 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
20 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
21 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
33 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
34 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
35 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
38 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
39 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
40 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
41 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
42 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
43 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
47 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
48 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
51 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
52 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
53 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
54 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
55 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
56 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
57 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
58 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
59 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
60 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
61 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
62 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
63 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
64 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
65 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
66 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
67 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
68 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
69 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
70 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
71 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
72 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
73 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
74 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
75 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
76 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
77 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
78 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
79 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
80 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
81 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
82 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
83 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
84 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
85 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
86 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
87 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
88 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
89 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
90 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
91 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
92 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_015443 3300042615 Bacteria 4180
2 Ga0466711_368777 3300042615 Bacteria 1957
3 Ga0466715_126027 3300042616 Bacteria 10289
4 Ga0466715_420420 3300042616 Bacteria 8782
5 Ga0466723_027968 3300042618 Bacteria 12243
6 Ga0466723_112529 3300042618 Bacteria 3243
7 Ga0466726_032841 3300042619 Bacteria 3186
8 Ga0466726_109258 3300042619 Bacteria 2231
9 Ga0466726_167838 3300042619 Bacteria 1268
10 Ga0466726_198352 3300042619 Bacteria 4061
11 Ga0466726_241234 3300042619 Bacteria 1285
12 Ga0160446_103839 3300012835 Bacteria 2306
13 Ga0466690_151120 3300042590 Bacteria 3674
14 Ga0466690_354258 3300042590 Bacteria 3984
15 Ga0466692_147599 3300042591 Bacteria 7388
16 Ga0466693_013592 3300042592 Bacteria 23207
17 Ga0466693_113574 3300042592 Unclassified 1802
18 Ga0466694_259995 3300042594 Bacteria 1359
19 Ga0466699_203081 3300042597 Unclassified 1498
20 Ga0466719_010301 3300042606 Bacteria 1875
21 Ga0466719_418256 3300042606 Bacteria 4550
22 Ga0466721_070381 3300042608 Bacteria 3161
23 Ga0466703_319445 3300042636 Bacteria 75536
24 Ga0466708_101573 3300042652 Bacteria 4746
25 Ga0466727_334468 3300042655 Bacteria 1387
26 Ga0123356_10114646 3300010049 Bacteria 2610
27 Ga0160471_100493 3300012812 Unclassified 10837
28 AustNasuHG_c1000593 3300000089 Bacteria 12790
29 JGI24698J34947_10000783 3300002449 Bacteria 15795
30 JGI24698J34947_10000948 3300002449 Bacteria 14766
31 JGI24698J34947_10034066 3300002449 Bacteria 2668
32 JGI24698J34947_10055814 3300002449 Unclassified 1966
33 JGI24698J34947_10104948 3300002449 Unclassified 1261
34 JGI24695J34938_10001809 3300002450 Bacteria 17535
35 JGI24695J34938_10038985 3300002450 Unclassified 2149
36 Ga0466712_147937 3300042614 Bacteria 10406
37 Ga0466712_206793 3300042614 Bacteria 56374
38 Ga0466711_196136 3300042615 Bacteria 15807
39 Ga0466715_007365 3300042616 Bacteria 14222
40 Ga0466715_542882 3300042616 Bacteria 2622
41 Ga0466718_025480 3300042617 Unclassified 3814
42 Ga0466718_066993 3300042617 Bacteria 2904
43 Ga0466728_139233 3300042620 Bacteria 8955
44 Ga0466728_400329 3300042620 Bacteria 7662
45 Ga0160467_101029 3300012829 Unclassified 14974
46 Ga0415639_094007 3300038395 Unclassified 2122
47 Ga0466692_167772 3300042591 Bacteria 2425
48 Ga0466691_066754 3300042593 Bacteria 8155
49 Ga0466691_143082 3300042593 Bacteria 13958
50 Ga0466694_017978 3300042594 Bacteria 19992
51 Ga0466694_313319 3300042594 Bacteria 12405
52 Ga0466695_273492 3300042595 Unclassified 1370
53 Ga0466699_115200 3300042597 Bacteria 13018
54 Ga0466699_135749 3300042597 Unclassified 1970
55 Ga0466699_317060 3300042597 Bacteria 14516
56 Ga0466700_027755 3300042600 Bacteria 1973
57 Ga0466700_104932 3300042600 Bacteria 1247
58 Ga0466719_399663 3300042606 Bacteria 12032
59 Ga0466722_041005 3300042609 Bacteria 32391
60 Ga0466698_084999 3300042610 Bacteria 2509
61 Ga0466735_000424 3300042624 Bacteria 2007
62 Ga0466735_184338 3300042624 Bacteria 1632
63 Ga0466703_377131 3300042636 Bacteria 16406
64 Ga0466704_037812 3300042643 Bacteria 10610
65 Ga0466704_487803 3300042643 Bacteria 7418
66 Ga0466727_027572 3300042655 Bacteria 4269
67 Ga0123356_10006606 3300010049 Bacteria 11688
68 Ga0123353_10356299 3300010167 Archaea 2201
69 AustNasuHG_c1003607 3300000089 Bacteria 5580
70 JGI24698J34947_10065234 3300002449 Unclassified 1776
71 Ga0072940_1014418 3300005200 Bacteria 17599
72 Ga0072941_1102036 3300005201 Bacteria 3271
73 Ga0466705_107375 3300042612 Bacteria 9174
74 Ga0466705_263254 3300042612 Bacteria 11192
75 Ga0466718_138405 3300042617 Unclassified 3098
76 Ga0466723_031170 3300042618 Bacteria 9516
77 Ga0466723_264171 3300042618 Bacteria 6127
78 Ga0160435_1010612 3300012857 Bacteria 1906
79 Ga0415639_051587 3300038395 Bacteria 1306
80 Ga0466692_067557 3300042591 Bacteria 2110
81 Ga0466694_223825 3300042594 Bacteria 36366
82 Ga0466713_045525 3300042602 Bacteria 77003
83 Ga0466713_106669 3300042602 Bacteria 30264
84 Ga0466717_222088 3300042604 Bacteria 1816
85 Ga0466719_013872 3300042606 Bacteria 15073
86 Ga0466720_154309 3300042607 Bacteria 2610
87 Ga0466722_220057 3300042609 Bacteria 3232
88 Ga0466731_141891 3300042622 Bacteria 5618
89 Ga0466703_058672 3300042636 Bacteria 8121
90 Ga0466709_038779 3300042648 Bacteria 4554
91 Ga0466708_072673 3300042652 Bacteria 9670
92 Ga0466708_205908 3300042652 Bacteria 27823
93 Ga0466725_050282 3300042654 Bacteria 2116
94 Ga0123356_10000059 3300010049 Bacteria 117133
95 Ga0123353_10075555 3300010167 Bacteria 5414
96 Ga0123353_10251629 3300010167 Bacteria 2736
97 Ga0123353_10500752 3300010167 Bacteria 1770
98 JGI24698J34947_10009451 3300002449 Bacteria 5352
99 JGI24695J34938_10000188 3300002450 Bacteria 57980
100 JGI24695J34938_10000275 3300002450 Bacteria 50395
101 JGI24695J34938_10001740 3300002450 Bacteria 18007
102 JGI24695J34938_10002343 3300002450 Bacteria 14590
103 JGI24695J34938_10002808 3300002450 Bacteria 12741
104 JGI24695J34938_10002901 3300002450 Bacteria 12462
105 Ga0072941_1004431 3300005201 Bacteria 21264
106 Ga0466732_275648 3300042656 Bacteria 12113
107 Ga0466712_190627 3300042614 Bacteria 15042
108 Ga0466712_287515 3300042614 Unclassified 3108
109 Ga0466712_299764 3300042614 Bacteria 1309
110 Ga0466715_228101 3300042616 Bacteria 9032
111 Ga0466718_011087 3300042617 Unclassified 7027
112 Ga0466723_274947 3300042618 Unclassified 4992
113 Ga0466726_318127 3300042619 Unclassified 3813
114 Ga0160434_101084 3300012850 Unclassified 5478
115 Ga0160430_100978 3300012852 Bacteria 12254
116 Ga0466657_337033 3300042582 Unclassified 3694
117 Ga0466692_100460 3300042591 Unclassified 2758
118 Ga0466691_052306 3300042593 Bacteria 11250
119 Ga0466696_024052 3300042596 Unclassified 3978
120 Ga0466716_307418 3300042605 Bacteria 12386
121 Ga0466719_072037 3300042606 Bacteria 31613
122 Ga0466721_324983 3300042608 Bacteria 3643
123 Ga0466722_183619 3300042609 Bacteria 11496
124 Ga0466704_058556 3300042643 Bacteria 2749
125 Ga0466708_462981 3300042652 Bacteria 13600
126 Ga0123357_10004871 3300009784 Bacteria 15912
127 Ga0123357_10026254 3300009784 Bacteria 7867
128 Ga0123357_10112119 3300009784 Bacteria 3472
129 Ga0123356_10001025 3300010049 Bacteria 31099
130 Ga0123353_10018212 3300010167 Bacteria 10373
131 AustNasuHG_c1026188 3300000089 Unclassified 1820
132 AustNasuHG_c1028288 3300000089 Bacteria 1678
133 JGI24698J34947_10003640 3300002449 Bacteria 8374
134 JGI24698J34947_10027404 3300002449 Bacteria 3023
135 JGI24695J34938_10000330 3300002450 Bacteria 46667
136 JGI24695J34938_10002111 3300002450 Bacteria 15564
137 Ga0072940_1339917 3300005200 Bacteria 4031
138 Ga0466733_123140 3300042659 Bacteria 2999
139 Ga0466712_031859 3300042614 Bacteria 22670
140 Ga0466712_147731 3300042614 Unclassified 9189
141 Ga0466712_250537 3300042614 Unclassified 8826
142 Ga0466711_404508 3300042615 Bacteria 3396
143 Ga0466715_030002 3300042616 Bacteria 2346
144 Ga0466715_065172 3300042616 Bacteria 13832
145 Ga0466718_038176 3300042617 Unclassified 2225
146 Ga0466723_032560 3300042618 Bacteria 7138
147 Ga0466723_372192 3300042618 Bacteria 10558
148 Ga0264413_141106 3300024493 Bacteria 5104
149 Ga0415639_005280 3300038395 Bacteria 15277
150 Ga0466694_005840 3300042594 Bacteria 106514
151 Ga0466694_319170 3300042594 Bacteria 18383
152 Ga0466696_182029 3300042596 Bacteria 8518
153 Ga0466713_132125 3300042602 Unclassified 6114
154 Ga0466716_288310 3300042605 Bacteria 5107
155 Ga0466716_346070 3300042605 Bacteria 7367
156 Ga0466719_169275 3300042606 Bacteria 7475
157 Ga0466719_352039 3300042606 Bacteria 46133
158 Ga0466720_159639 3300042607 Unclassified 2539
159 Ga0466720_180977 3300042607 Unclassified 2508
160 Ga0466722_053417 3300042609 Bacteria 5935
161 Ga0466722_089788 3300042609 Bacteria 4342
162 Ga0466729_313331 3300042621 Bacteria 1634
163 Ga0466735_037154 3300042624 Unclassified 1335
164 Ga0466703_037120 3300042636 Bacteria 4518
165 Ga0466703_101910 3300042636 Bacteria 3358
166 Ga0466704_062758 3300042643 Bacteria 22508
167 Ga0466704_341635 3300042643 Bacteria 32677
168 Ga0466709_196036 3300042648 Bacteria 14087
169 Ga0466709_274375 3300042648 Bacteria 5285
170 Ga0466709_302882 3300042648 Bacteria 10958
171 Ga0466708_294278 3300042652 Bacteria 26571
172 Ga0466708_432945 3300042652 Bacteria 10149
173 Ga0466727_030378 3300042655 Bacteria 2582
174 Ga0123353_10142834 3300010167 Bacteria 3832
175 AustNasuHG_c1000357 3300000089 Bacteria 15851
176 JGI24698J34947_10005573 3300002449 Bacteria 6908
177 JGI24698J34947_10006634 3300002449 Bacteria 6359
178 JGI24698J34947_10016965 3300002449 Bacteria 3951
179 JGI24698J34947_10039780 3300002449 Unclassified 2432
180 JGI24698J34947_10066355 3300002449 Unclassified 1756
181 Ga0072941_1038054 3300005201 Bacteria 11665
182 Ga0466705_037154 3300042612 Unclassified 3217
183 Ga0466732_435549 3300042656 Bacteria 1596
184 Ga0466712_003016 3300042614 Bacteria 7278
185 Ga0466712_070208 3300042614 Bacteria 13324
186 Ga0466712_140123 3300042614 Bacteria 10510
187 Ga0466712_145211 3300042614 Bacteria 4227
188 Ga0466712_171718 3300042614 Bacteria 14556
189 Ga0466711_453144 3300042615 Bacteria 8064
190 Ga0466715_345201 3300042616 Bacteria 10898
191 Ga0466715_352994 3300042616 Bacteria 10888
192 Ga0466726_431604 3300042619 Bacteria 2354
193 Ga0160440_100211 3300012815 Unclassified 44317
194 Ga0160446_103730 3300012835 Unclassified 2358
195 Ga0160472_102829 3300012839 Unclassified 3711
196 Ga0466692_106900 3300042591 Bacteria 7911
197 Ga0466692_194071 3300042591 Bacteria 1931
198 Ga0466695_221003 3300042595 Bacteria 17939
199 Ga0466696_291019 3300042596 Bacteria 2719
200 Ga0466700_014680 3300042600 Bacteria 2798
201 Ga0466713_106046 3300042602 Bacteria 1991
202 Ga0466720_095040 3300042607 Bacteria 11143
203 Ga0466720_110783 3300042607 Bacteria 12469
204 Ga0466722_108308 3300042609 Bacteria 42621
205 Ga0466722_152825 3300042609 Bacteria 3705
206 Ga0466734_147530 3300042623 Unclassified 13914
207 Ga0466704_063920 3300042643 Unclassified 1481
208 Ga0466709_025375 3300042648 Bacteria 3584
209 Ga0466708_131026 3300042652 Unclassified 2241
210 Ga0466708_307292 3300042652 Bacteria 9295
211 Ga0466725_328377 3300042654 Unclassified 1183
212 Ga0466727_197135 3300042655 Bacteria 3658
213 Ga0466727_287974 3300042655 Bacteria 2097
214 Ga0123357_10091837 3300009784 Bacteria 3952
215 Ga0123355_10033019 3300009826 Bacteria 8403
216 Ga0123356_10000619 3300010049 Bacteria 39296
217 Ga0123356_10003577 3300010049 Bacteria 16241
218 Ga0123356_10007528 3300010049 Bacteria 10860
219 Ga0123353_10203700 3300010167 Bacteria 3110
220 Ga0123353_10499983 3300010167 Bacteria 1772
221 Ga0123354_10166344 3300010882 Unclassified 2591
222 AustNasuHG_c1012256 3300000089 Unclassified 2960
223 JGI24698J34947_10002149 3300002449 Bacteria 10564
224 JGI24695J34938_10000054 3300002450 Bacteria 90526
225 Ga0072941_1000479 3300005201 Bacteria 37521
226 Ga0072941_1000480 3300005201 Bacteria 29122
227 Ga0072941_1089671 3300005201 Bacteria 1578
228 Ga0466705_116649 3300042612 Bacteria 7050
229 Ga0466705_246153 3300042612 Bacteria 2751
230 Ga0466705_379518 3300042612 Bacteria 16542
231 Ga0466732_276114 3300042656 Bacteria 2133
232 Ga0466712_007766 3300042614 Bacteria 9396
233 Ga0466712_036251 3300042614 Bacteria 44742
234 Ga0466712_202343 3300042614 Bacteria 4585
235 Ga0466711_240100 3300042615 Bacteria 2664
236 Ga0466715_152306 3300042616 Bacteria 11168
237 Ga0466718_061498 3300042617 Bacteria 1900
238 Ga0466723_191925 3300042618 Bacteria 8301
239 Ga0466728_093579 3300042620 Bacteria 14784
240 Ga0264413_111745 3300024493 Bacteria 49890
241 Ga0466696_217068 3300042596 Bacteria 4082
242 Ga0466699_070785 3300042597 Unclassified 2648
243 Ga0466700_139633 3300042600 Bacteria 1366
244 Ga0466700_140498 3300042600 Bacteria 4212
245 Ga0466713_061838 3300042602 Unclassified 10052
246 Ga0466717_311434 3300042604 Bacteria 1362
247 Ga0466720_234456 3300042607 Bacteria 15202
248 Ga0466722_063901 3300042609 Unclassified 2878
249 Ga0466722_124905 3300042609 Bacteria 2351
250 Ga0466729_242066 3300042621 Bacteria 1772
251 Ga0466735_007687 3300042624 Bacteria 4636
252 Ga0466703_109417 3300042636 Bacteria 11855
253 Ga0466709_225193 3300042648 Bacteria 12324
254 Ga0466709_374626 3300042648 Bacteria 8341
255 Ga0466708_017891 3300042652 Bacteria 6316
256 Ga0466708_122674 3300042652 Bacteria 1841
257 JGI24698J34947_10002999 3300002449 Bacteria 9153
258 JGI24695J34938_10000650 3300002450 Bacteria 33205
259 JGI24695J34938_10001578 3300002450 Bacteria 19188
260 JGI24695J34938_10007799 3300002450 Bacteria 6203
261 JGI24695J34938_10027655 3300002450 Unclassified 2677
262 Ga0068305_10063606 3300005083 Unclassified 3901
263 Ga0072941_1013753 3300005201 Bacteria 19926
264 Ga0466705_286364 3300042612 Bacteria 9207
265 Ga0466732_140346 3300042656 Bacteria 6897
266 Ga0466712_010653 3300042614 Unclassified 5410
267 Ga0466712_042932 3300042614 Bacteria 11222
268 Ga0466712_158778 3300042614 Bacteria 14227
269 Ga0466711_076609 3300042615 Bacteria 16760
270 Ga0466711_270490 3300042615 Bacteria 3684
271 Ga0466715_346454 3300042616 Bacteria 16047
272 Ga0466718_010176 3300042617 Bacteria 1847
273 Ga0466718_167628 3300042617 Bacteria 2650
274 Ga0466723_036215 3300042618 Bacteria 2910
275 Ga0466728_130456 3300042620 Bacteria 4946
276 Ga0160458_102829 3300012832 Unclassified 2271
277 Ga0160472_104780 3300012839 Unclassified 2304
278 Ga0160447_102237 3300012849 Unclassified 6933
279 Ga0415639_038398 3300038395 Bacteria 5131
280 Ga0415639_052117 3300038395 Bacteria 5823
281 Ga0466690_100903 3300042590 Unclassified 3473
282 Ga0466690_110527 3300042590 Bacteria 7398
283 Ga0466692_035804 3300042591 Bacteria 1832
284 Ga0466692_105609 3300042591 Bacteria 14269
285 Ga0466692_121077 3300042591 Bacteria 3169
286 Ga0466692_167901 3300042591 Unclassified 1175
287 Ga0466693_279320 3300042592 Bacteria 20627
288 Ga0466691_020887 3300042593 Bacteria 13836
289 Ga0466695_154361 3300042595 Bacteria 1351
290 Ga0466699_173544 3300042597 Bacteria 12684
291 Ga0466701_035736 3300042598 Bacteria 2041
292 Ga0466700_451957 3300042600 Unclassified 2469
293 Ga0466707_002386 3300042601 Bacteria 1704
294 Ga0466707_328035 3300042601 Bacteria 1539
295 Ga0466707_379823 3300042601 Bacteria 13752
296 Ga0466713_117127 3300042602 Unclassified 16638
297 Ga0466717_023347 3300042604 Bacteria 1291
298 Ga0466720_023009 3300042607 Bacteria 3386
299 Ga0466722_093580 3300042609 Bacteria 8041
300 Ga0466735_047155 3300042624 Bacteria 4967
301 Ga0466702_267521 3300042635 Bacteria 1911
302 Ga0466703_247878 3300042636 Bacteria 13092
303 Ga0466703_256443 3300042636 Bacteria 11097
304 Ga0466703_271320 3300042636 Bacteria 21340
305 Ga0466703_278279 3300042636 Bacteria 2190
306 Ga0466704_363605 3300042643 Bacteria 11317
307 Ga0466704_540541 3300042643 Unclassified 5464
308 Ga0466709_032120 3300042648 Bacteria 4675
309 Ga0466709_070696 3300042648 Bacteria 17498
310 Ga0466727_283617 3300042655 Bacteria 2734
311 Ga0123357_10131527 3300009784 Unclassified 3113
312 Ga0123355_10487169 3300009826 Bacteria 1530
313 Ga0123356_10012770 3300010049 Bacteria 8132
314 Ga0123353_10283437 3300010167 Bacteria 2542
315 Ga0123353_10285969 3300010167 Bacteria 2528
316 Ga0123353_10707845 3300010167 Bacteria 1412
317 Ga0123354_10209678 3300010882 Bacteria 2110
318 Ga0160466_107663 3300012809 Unclassified 1257
319 AustNasuHG_c1003168 3300000089 Bacteria 5935
320 JGI24698J34947_10040332 3300002449 Unclassified 2411
321 JGI24698J34947_10052286 3300002449 Unclassified 2051
322 JGI24698J34947_10065316 3300002449 Bacteria 1774
323 JGI24695J34938_10003348 3300002450 Bacteria 11275
324 JGI24695J34938_10006049 3300002450 Bacteria 7373
325 JGI24695J34938_10007018 3300002450 Bacteria 6674
326 JGI24695J34938_10015378 3300002450 Bacteria 3928
327 JGI24702J35022_10156840 3300002462 Bacteria 1280

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 62 192 1
PF17863 AAA_lid_2 AAA lid domain 260 329 0.95
PF07728 AAA_5 AAA domain (dynein-related subfamily) 62 190 0.92
PF20030 bpMoxR MoxR domain in the MoxR-vWA-beta-propeller ternary systems 31 198 0.84

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.