Protein Family IF07633
Metagenome
Isolate
354
Members
92
Samples
327
Scaffolds
330.11
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_065172|Ga0466715_065172_10418_11527
- Length
- 369 aa
- Sequence
- MTAENRNTADHASDRAADFTSHPASGSASRALRLVKEEIAKAFIGQASLVDHALITALAGGHLLVEGVPGLGKTLLVRALARAIGGESRRVQFTPDLMPGDITGSIMLDTGSGKFITRKGPVFTNFFIADEINRAPAKTQAALFEAMQEFQVSLDGTAYPLPEPFMVLATENPFEHEGTYPLPDAQKDRFLMKVIASYPAPEEEIAMVSMVLAEDTGAMLSVDDVETVLPPGGFSALRSFAARIRTDPLVIDYAVRLCAATRNDPHAETGAGPRGSLALIRCARARALLEGRGFVLPDDVKALAVPVLAHRLTLSAESELEGLDERRIILNLVAGIEAPRLPPPVPEGEVLPPAXEEGRGAAAAGGASS
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.5%
Unclassified
31.0%
Kalotermitidae
16.1%
Culicidae
8.0%
Rhinotermitidae
3.4%
Termopsidae
3.4%
Armadillidiidae
1.1%
Scarabaeidae
1.1%
Alydidae
1.1%
Taxonomy
Archaea
1
Bacteria
294
Eukaryota
0
Viruses
0
Unclassified
59
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 3 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 12 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 19 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 20 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 21 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 33 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 34 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 35 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 38 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 39 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 40 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 41 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 42 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 47 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 48 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 53 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 54 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 55 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 56 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 57 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 58 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 59 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 60 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 61 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 62 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 63 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 64 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 65 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 66 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 67 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 68 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 69 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 70 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 71 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 72 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 73 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 74 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 75 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 76 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 77 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 78 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 79 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 80 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 81 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 82 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 83 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 84 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 85 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 86 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 87 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 88 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 89 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 90 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 91 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 92 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_015443 | 3300042615 | Bacteria | 4180 |
| 2 | Ga0466711_368777 | 3300042615 | Bacteria | 1957 |
| 3 | Ga0466715_126027 | 3300042616 | Bacteria | 10289 |
| 4 | Ga0466715_420420 | 3300042616 | Bacteria | 8782 |
| 5 | Ga0466723_027968 | 3300042618 | Bacteria | 12243 |
| 6 | Ga0466723_112529 | 3300042618 | Bacteria | 3243 |
| 7 | Ga0466726_032841 | 3300042619 | Bacteria | 3186 |
| 8 | Ga0466726_109258 | 3300042619 | Bacteria | 2231 |
| 9 | Ga0466726_167838 | 3300042619 | Bacteria | 1268 |
| 10 | Ga0466726_198352 | 3300042619 | Bacteria | 4061 |
| 11 | Ga0466726_241234 | 3300042619 | Bacteria | 1285 |
| 12 | Ga0160446_103839 | 3300012835 | Bacteria | 2306 |
| 13 | Ga0466690_151120 | 3300042590 | Bacteria | 3674 |
| 14 | Ga0466690_354258 | 3300042590 | Bacteria | 3984 |
| 15 | Ga0466692_147599 | 3300042591 | Bacteria | 7388 |
| 16 | Ga0466693_013592 | 3300042592 | Bacteria | 23207 |
| 17 | Ga0466693_113574 | 3300042592 | Unclassified | 1802 |
| 18 | Ga0466694_259995 | 3300042594 | Bacteria | 1359 |
| 19 | Ga0466699_203081 | 3300042597 | Unclassified | 1498 |
| 20 | Ga0466719_010301 | 3300042606 | Bacteria | 1875 |
| 21 | Ga0466719_418256 | 3300042606 | Bacteria | 4550 |
| 22 | Ga0466721_070381 | 3300042608 | Bacteria | 3161 |
| 23 | Ga0466703_319445 | 3300042636 | Bacteria | 75536 |
| 24 | Ga0466708_101573 | 3300042652 | Bacteria | 4746 |
| 25 | Ga0466727_334468 | 3300042655 | Bacteria | 1387 |
| 26 | Ga0123356_10114646 | 3300010049 | Bacteria | 2610 |
| 27 | Ga0160471_100493 | 3300012812 | Unclassified | 10837 |
| 28 | AustNasuHG_c1000593 | 3300000089 | Bacteria | 12790 |
| 29 | JGI24698J34947_10000783 | 3300002449 | Bacteria | 15795 |
| 30 | JGI24698J34947_10000948 | 3300002449 | Bacteria | 14766 |
| 31 | JGI24698J34947_10034066 | 3300002449 | Bacteria | 2668 |
| 32 | JGI24698J34947_10055814 | 3300002449 | Unclassified | 1966 |
| 33 | JGI24698J34947_10104948 | 3300002449 | Unclassified | 1261 |
| 34 | JGI24695J34938_10001809 | 3300002450 | Bacteria | 17535 |
| 35 | JGI24695J34938_10038985 | 3300002450 | Unclassified | 2149 |
| 36 | Ga0466712_147937 | 3300042614 | Bacteria | 10406 |
| 37 | Ga0466712_206793 | 3300042614 | Bacteria | 56374 |
| 38 | Ga0466711_196136 | 3300042615 | Bacteria | 15807 |
| 39 | Ga0466715_007365 | 3300042616 | Bacteria | 14222 |
| 40 | Ga0466715_542882 | 3300042616 | Bacteria | 2622 |
| 41 | Ga0466718_025480 | 3300042617 | Unclassified | 3814 |
| 42 | Ga0466718_066993 | 3300042617 | Bacteria | 2904 |
| 43 | Ga0466728_139233 | 3300042620 | Bacteria | 8955 |
| 44 | Ga0466728_400329 | 3300042620 | Bacteria | 7662 |
| 45 | Ga0160467_101029 | 3300012829 | Unclassified | 14974 |
| 46 | Ga0415639_094007 | 3300038395 | Unclassified | 2122 |
| 47 | Ga0466692_167772 | 3300042591 | Bacteria | 2425 |
| 48 | Ga0466691_066754 | 3300042593 | Bacteria | 8155 |
| 49 | Ga0466691_143082 | 3300042593 | Bacteria | 13958 |
| 50 | Ga0466694_017978 | 3300042594 | Bacteria | 19992 |
| 51 | Ga0466694_313319 | 3300042594 | Bacteria | 12405 |
| 52 | Ga0466695_273492 | 3300042595 | Unclassified | 1370 |
| 53 | Ga0466699_115200 | 3300042597 | Bacteria | 13018 |
| 54 | Ga0466699_135749 | 3300042597 | Unclassified | 1970 |
| 55 | Ga0466699_317060 | 3300042597 | Bacteria | 14516 |
| 56 | Ga0466700_027755 | 3300042600 | Bacteria | 1973 |
| 57 | Ga0466700_104932 | 3300042600 | Bacteria | 1247 |
| 58 | Ga0466719_399663 | 3300042606 | Bacteria | 12032 |
| 59 | Ga0466722_041005 | 3300042609 | Bacteria | 32391 |
| 60 | Ga0466698_084999 | 3300042610 | Bacteria | 2509 |
| 61 | Ga0466735_000424 | 3300042624 | Bacteria | 2007 |
| 62 | Ga0466735_184338 | 3300042624 | Bacteria | 1632 |
| 63 | Ga0466703_377131 | 3300042636 | Bacteria | 16406 |
| 64 | Ga0466704_037812 | 3300042643 | Bacteria | 10610 |
| 65 | Ga0466704_487803 | 3300042643 | Bacteria | 7418 |
| 66 | Ga0466727_027572 | 3300042655 | Bacteria | 4269 |
| 67 | Ga0123356_10006606 | 3300010049 | Bacteria | 11688 |
| 68 | Ga0123353_10356299 | 3300010167 | Archaea | 2201 |
| 69 | AustNasuHG_c1003607 | 3300000089 | Bacteria | 5580 |
| 70 | JGI24698J34947_10065234 | 3300002449 | Unclassified | 1776 |
| 71 | Ga0072940_1014418 | 3300005200 | Bacteria | 17599 |
| 72 | Ga0072941_1102036 | 3300005201 | Bacteria | 3271 |
| 73 | Ga0466705_107375 | 3300042612 | Bacteria | 9174 |
| 74 | Ga0466705_263254 | 3300042612 | Bacteria | 11192 |
| 75 | Ga0466718_138405 | 3300042617 | Unclassified | 3098 |
| 76 | Ga0466723_031170 | 3300042618 | Bacteria | 9516 |
| 77 | Ga0466723_264171 | 3300042618 | Bacteria | 6127 |
| 78 | Ga0160435_1010612 | 3300012857 | Bacteria | 1906 |
| 79 | Ga0415639_051587 | 3300038395 | Bacteria | 1306 |
| 80 | Ga0466692_067557 | 3300042591 | Bacteria | 2110 |
| 81 | Ga0466694_223825 | 3300042594 | Bacteria | 36366 |
| 82 | Ga0466713_045525 | 3300042602 | Bacteria | 77003 |
| 83 | Ga0466713_106669 | 3300042602 | Bacteria | 30264 |
| 84 | Ga0466717_222088 | 3300042604 | Bacteria | 1816 |
| 85 | Ga0466719_013872 | 3300042606 | Bacteria | 15073 |
| 86 | Ga0466720_154309 | 3300042607 | Bacteria | 2610 |
| 87 | Ga0466722_220057 | 3300042609 | Bacteria | 3232 |
| 88 | Ga0466731_141891 | 3300042622 | Bacteria | 5618 |
| 89 | Ga0466703_058672 | 3300042636 | Bacteria | 8121 |
| 90 | Ga0466709_038779 | 3300042648 | Bacteria | 4554 |
| 91 | Ga0466708_072673 | 3300042652 | Bacteria | 9670 |
| 92 | Ga0466708_205908 | 3300042652 | Bacteria | 27823 |
| 93 | Ga0466725_050282 | 3300042654 | Bacteria | 2116 |
| 94 | Ga0123356_10000059 | 3300010049 | Bacteria | 117133 |
| 95 | Ga0123353_10075555 | 3300010167 | Bacteria | 5414 |
| 96 | Ga0123353_10251629 | 3300010167 | Bacteria | 2736 |
| 97 | Ga0123353_10500752 | 3300010167 | Bacteria | 1770 |
| 98 | JGI24698J34947_10009451 | 3300002449 | Bacteria | 5352 |
| 99 | JGI24695J34938_10000188 | 3300002450 | Bacteria | 57980 |
| 100 | JGI24695J34938_10000275 | 3300002450 | Bacteria | 50395 |
| 101 | JGI24695J34938_10001740 | 3300002450 | Bacteria | 18007 |
| 102 | JGI24695J34938_10002343 | 3300002450 | Bacteria | 14590 |
| 103 | JGI24695J34938_10002808 | 3300002450 | Bacteria | 12741 |
| 104 | JGI24695J34938_10002901 | 3300002450 | Bacteria | 12462 |
| 105 | Ga0072941_1004431 | 3300005201 | Bacteria | 21264 |
| 106 | Ga0466732_275648 | 3300042656 | Bacteria | 12113 |
| 107 | Ga0466712_190627 | 3300042614 | Bacteria | 15042 |
| 108 | Ga0466712_287515 | 3300042614 | Unclassified | 3108 |
| 109 | Ga0466712_299764 | 3300042614 | Bacteria | 1309 |
| 110 | Ga0466715_228101 | 3300042616 | Bacteria | 9032 |
| 111 | Ga0466718_011087 | 3300042617 | Unclassified | 7027 |
| 112 | Ga0466723_274947 | 3300042618 | Unclassified | 4992 |
| 113 | Ga0466726_318127 | 3300042619 | Unclassified | 3813 |
| 114 | Ga0160434_101084 | 3300012850 | Unclassified | 5478 |
| 115 | Ga0160430_100978 | 3300012852 | Bacteria | 12254 |
| 116 | Ga0466657_337033 | 3300042582 | Unclassified | 3694 |
| 117 | Ga0466692_100460 | 3300042591 | Unclassified | 2758 |
| 118 | Ga0466691_052306 | 3300042593 | Bacteria | 11250 |
| 119 | Ga0466696_024052 | 3300042596 | Unclassified | 3978 |
| 120 | Ga0466716_307418 | 3300042605 | Bacteria | 12386 |
| 121 | Ga0466719_072037 | 3300042606 | Bacteria | 31613 |
| 122 | Ga0466721_324983 | 3300042608 | Bacteria | 3643 |
| 123 | Ga0466722_183619 | 3300042609 | Bacteria | 11496 |
| 124 | Ga0466704_058556 | 3300042643 | Bacteria | 2749 |
| 125 | Ga0466708_462981 | 3300042652 | Bacteria | 13600 |
| 126 | Ga0123357_10004871 | 3300009784 | Bacteria | 15912 |
| 127 | Ga0123357_10026254 | 3300009784 | Bacteria | 7867 |
| 128 | Ga0123357_10112119 | 3300009784 | Bacteria | 3472 |
| 129 | Ga0123356_10001025 | 3300010049 | Bacteria | 31099 |
| 130 | Ga0123353_10018212 | 3300010167 | Bacteria | 10373 |
| 131 | AustNasuHG_c1026188 | 3300000089 | Unclassified | 1820 |
| 132 | AustNasuHG_c1028288 | 3300000089 | Bacteria | 1678 |
| 133 | JGI24698J34947_10003640 | 3300002449 | Bacteria | 8374 |
| 134 | JGI24698J34947_10027404 | 3300002449 | Bacteria | 3023 |
| 135 | JGI24695J34938_10000330 | 3300002450 | Bacteria | 46667 |
| 136 | JGI24695J34938_10002111 | 3300002450 | Bacteria | 15564 |
| 137 | Ga0072940_1339917 | 3300005200 | Bacteria | 4031 |
| 138 | Ga0466733_123140 | 3300042659 | Bacteria | 2999 |
| 139 | Ga0466712_031859 | 3300042614 | Bacteria | 22670 |
| 140 | Ga0466712_147731 | 3300042614 | Unclassified | 9189 |
| 141 | Ga0466712_250537 | 3300042614 | Unclassified | 8826 |
| 142 | Ga0466711_404508 | 3300042615 | Bacteria | 3396 |
| 143 | Ga0466715_030002 | 3300042616 | Bacteria | 2346 |
| 144 | Ga0466715_065172 | 3300042616 | Bacteria | 13832 |
| 145 | Ga0466718_038176 | 3300042617 | Unclassified | 2225 |
| 146 | Ga0466723_032560 | 3300042618 | Bacteria | 7138 |
| 147 | Ga0466723_372192 | 3300042618 | Bacteria | 10558 |
| 148 | Ga0264413_141106 | 3300024493 | Bacteria | 5104 |
| 149 | Ga0415639_005280 | 3300038395 | Bacteria | 15277 |
| 150 | Ga0466694_005840 | 3300042594 | Bacteria | 106514 |
| 151 | Ga0466694_319170 | 3300042594 | Bacteria | 18383 |
| 152 | Ga0466696_182029 | 3300042596 | Bacteria | 8518 |
| 153 | Ga0466713_132125 | 3300042602 | Unclassified | 6114 |
| 154 | Ga0466716_288310 | 3300042605 | Bacteria | 5107 |
| 155 | Ga0466716_346070 | 3300042605 | Bacteria | 7367 |
| 156 | Ga0466719_169275 | 3300042606 | Bacteria | 7475 |
| 157 | Ga0466719_352039 | 3300042606 | Bacteria | 46133 |
| 158 | Ga0466720_159639 | 3300042607 | Unclassified | 2539 |
| 159 | Ga0466720_180977 | 3300042607 | Unclassified | 2508 |
| 160 | Ga0466722_053417 | 3300042609 | Bacteria | 5935 |
| 161 | Ga0466722_089788 | 3300042609 | Bacteria | 4342 |
| 162 | Ga0466729_313331 | 3300042621 | Bacteria | 1634 |
| 163 | Ga0466735_037154 | 3300042624 | Unclassified | 1335 |
| 164 | Ga0466703_037120 | 3300042636 | Bacteria | 4518 |
| 165 | Ga0466703_101910 | 3300042636 | Bacteria | 3358 |
| 166 | Ga0466704_062758 | 3300042643 | Bacteria | 22508 |
| 167 | Ga0466704_341635 | 3300042643 | Bacteria | 32677 |
| 168 | Ga0466709_196036 | 3300042648 | Bacteria | 14087 |
| 169 | Ga0466709_274375 | 3300042648 | Bacteria | 5285 |
| 170 | Ga0466709_302882 | 3300042648 | Bacteria | 10958 |
| 171 | Ga0466708_294278 | 3300042652 | Bacteria | 26571 |
| 172 | Ga0466708_432945 | 3300042652 | Bacteria | 10149 |
| 173 | Ga0466727_030378 | 3300042655 | Bacteria | 2582 |
| 174 | Ga0123353_10142834 | 3300010167 | Bacteria | 3832 |
| 175 | AustNasuHG_c1000357 | 3300000089 | Bacteria | 15851 |
| 176 | JGI24698J34947_10005573 | 3300002449 | Bacteria | 6908 |
| 177 | JGI24698J34947_10006634 | 3300002449 | Bacteria | 6359 |
| 178 | JGI24698J34947_10016965 | 3300002449 | Bacteria | 3951 |
| 179 | JGI24698J34947_10039780 | 3300002449 | Unclassified | 2432 |
| 180 | JGI24698J34947_10066355 | 3300002449 | Unclassified | 1756 |
| 181 | Ga0072941_1038054 | 3300005201 | Bacteria | 11665 |
| 182 | Ga0466705_037154 | 3300042612 | Unclassified | 3217 |
| 183 | Ga0466732_435549 | 3300042656 | Bacteria | 1596 |
| 184 | Ga0466712_003016 | 3300042614 | Bacteria | 7278 |
| 185 | Ga0466712_070208 | 3300042614 | Bacteria | 13324 |
| 186 | Ga0466712_140123 | 3300042614 | Bacteria | 10510 |
| 187 | Ga0466712_145211 | 3300042614 | Bacteria | 4227 |
| 188 | Ga0466712_171718 | 3300042614 | Bacteria | 14556 |
| 189 | Ga0466711_453144 | 3300042615 | Bacteria | 8064 |
| 190 | Ga0466715_345201 | 3300042616 | Bacteria | 10898 |
| 191 | Ga0466715_352994 | 3300042616 | Bacteria | 10888 |
| 192 | Ga0466726_431604 | 3300042619 | Bacteria | 2354 |
| 193 | Ga0160440_100211 | 3300012815 | Unclassified | 44317 |
| 194 | Ga0160446_103730 | 3300012835 | Unclassified | 2358 |
| 195 | Ga0160472_102829 | 3300012839 | Unclassified | 3711 |
| 196 | Ga0466692_106900 | 3300042591 | Bacteria | 7911 |
| 197 | Ga0466692_194071 | 3300042591 | Bacteria | 1931 |
| 198 | Ga0466695_221003 | 3300042595 | Bacteria | 17939 |
| 199 | Ga0466696_291019 | 3300042596 | Bacteria | 2719 |
| 200 | Ga0466700_014680 | 3300042600 | Bacteria | 2798 |
| 201 | Ga0466713_106046 | 3300042602 | Bacteria | 1991 |
| 202 | Ga0466720_095040 | 3300042607 | Bacteria | 11143 |
| 203 | Ga0466720_110783 | 3300042607 | Bacteria | 12469 |
| 204 | Ga0466722_108308 | 3300042609 | Bacteria | 42621 |
| 205 | Ga0466722_152825 | 3300042609 | Bacteria | 3705 |
| 206 | Ga0466734_147530 | 3300042623 | Unclassified | 13914 |
| 207 | Ga0466704_063920 | 3300042643 | Unclassified | 1481 |
| 208 | Ga0466709_025375 | 3300042648 | Bacteria | 3584 |
| 209 | Ga0466708_131026 | 3300042652 | Unclassified | 2241 |
| 210 | Ga0466708_307292 | 3300042652 | Bacteria | 9295 |
| 211 | Ga0466725_328377 | 3300042654 | Unclassified | 1183 |
| 212 | Ga0466727_197135 | 3300042655 | Bacteria | 3658 |
| 213 | Ga0466727_287974 | 3300042655 | Bacteria | 2097 |
| 214 | Ga0123357_10091837 | 3300009784 | Bacteria | 3952 |
| 215 | Ga0123355_10033019 | 3300009826 | Bacteria | 8403 |
| 216 | Ga0123356_10000619 | 3300010049 | Bacteria | 39296 |
| 217 | Ga0123356_10003577 | 3300010049 | Bacteria | 16241 |
| 218 | Ga0123356_10007528 | 3300010049 | Bacteria | 10860 |
| 219 | Ga0123353_10203700 | 3300010167 | Bacteria | 3110 |
| 220 | Ga0123353_10499983 | 3300010167 | Bacteria | 1772 |
| 221 | Ga0123354_10166344 | 3300010882 | Unclassified | 2591 |
| 222 | AustNasuHG_c1012256 | 3300000089 | Unclassified | 2960 |
| 223 | JGI24698J34947_10002149 | 3300002449 | Bacteria | 10564 |
| 224 | JGI24695J34938_10000054 | 3300002450 | Bacteria | 90526 |
| 225 | Ga0072941_1000479 | 3300005201 | Bacteria | 37521 |
| 226 | Ga0072941_1000480 | 3300005201 | Bacteria | 29122 |
| 227 | Ga0072941_1089671 | 3300005201 | Bacteria | 1578 |
| 228 | Ga0466705_116649 | 3300042612 | Bacteria | 7050 |
| 229 | Ga0466705_246153 | 3300042612 | Bacteria | 2751 |
| 230 | Ga0466705_379518 | 3300042612 | Bacteria | 16542 |
| 231 | Ga0466732_276114 | 3300042656 | Bacteria | 2133 |
| 232 | Ga0466712_007766 | 3300042614 | Bacteria | 9396 |
| 233 | Ga0466712_036251 | 3300042614 | Bacteria | 44742 |
| 234 | Ga0466712_202343 | 3300042614 | Bacteria | 4585 |
| 235 | Ga0466711_240100 | 3300042615 | Bacteria | 2664 |
| 236 | Ga0466715_152306 | 3300042616 | Bacteria | 11168 |
| 237 | Ga0466718_061498 | 3300042617 | Bacteria | 1900 |
| 238 | Ga0466723_191925 | 3300042618 | Bacteria | 8301 |
| 239 | Ga0466728_093579 | 3300042620 | Bacteria | 14784 |
| 240 | Ga0264413_111745 | 3300024493 | Bacteria | 49890 |
| 241 | Ga0466696_217068 | 3300042596 | Bacteria | 4082 |
| 242 | Ga0466699_070785 | 3300042597 | Unclassified | 2648 |
| 243 | Ga0466700_139633 | 3300042600 | Bacteria | 1366 |
| 244 | Ga0466700_140498 | 3300042600 | Bacteria | 4212 |
| 245 | Ga0466713_061838 | 3300042602 | Unclassified | 10052 |
| 246 | Ga0466717_311434 | 3300042604 | Bacteria | 1362 |
| 247 | Ga0466720_234456 | 3300042607 | Bacteria | 15202 |
| 248 | Ga0466722_063901 | 3300042609 | Unclassified | 2878 |
| 249 | Ga0466722_124905 | 3300042609 | Bacteria | 2351 |
| 250 | Ga0466729_242066 | 3300042621 | Bacteria | 1772 |
| 251 | Ga0466735_007687 | 3300042624 | Bacteria | 4636 |
| 252 | Ga0466703_109417 | 3300042636 | Bacteria | 11855 |
| 253 | Ga0466709_225193 | 3300042648 | Bacteria | 12324 |
| 254 | Ga0466709_374626 | 3300042648 | Bacteria | 8341 |
| 255 | Ga0466708_017891 | 3300042652 | Bacteria | 6316 |
| 256 | Ga0466708_122674 | 3300042652 | Bacteria | 1841 |
| 257 | JGI24698J34947_10002999 | 3300002449 | Bacteria | 9153 |
| 258 | JGI24695J34938_10000650 | 3300002450 | Bacteria | 33205 |
| 259 | JGI24695J34938_10001578 | 3300002450 | Bacteria | 19188 |
| 260 | JGI24695J34938_10007799 | 3300002450 | Bacteria | 6203 |
| 261 | JGI24695J34938_10027655 | 3300002450 | Unclassified | 2677 |
| 262 | Ga0068305_10063606 | 3300005083 | Unclassified | 3901 |
| 263 | Ga0072941_1013753 | 3300005201 | Bacteria | 19926 |
| 264 | Ga0466705_286364 | 3300042612 | Bacteria | 9207 |
| 265 | Ga0466732_140346 | 3300042656 | Bacteria | 6897 |
| 266 | Ga0466712_010653 | 3300042614 | Unclassified | 5410 |
| 267 | Ga0466712_042932 | 3300042614 | Bacteria | 11222 |
| 268 | Ga0466712_158778 | 3300042614 | Bacteria | 14227 |
| 269 | Ga0466711_076609 | 3300042615 | Bacteria | 16760 |
| 270 | Ga0466711_270490 | 3300042615 | Bacteria | 3684 |
| 271 | Ga0466715_346454 | 3300042616 | Bacteria | 16047 |
| 272 | Ga0466718_010176 | 3300042617 | Bacteria | 1847 |
| 273 | Ga0466718_167628 | 3300042617 | Bacteria | 2650 |
| 274 | Ga0466723_036215 | 3300042618 | Bacteria | 2910 |
| 275 | Ga0466728_130456 | 3300042620 | Bacteria | 4946 |
| 276 | Ga0160458_102829 | 3300012832 | Unclassified | 2271 |
| 277 | Ga0160472_104780 | 3300012839 | Unclassified | 2304 |
| 278 | Ga0160447_102237 | 3300012849 | Unclassified | 6933 |
| 279 | Ga0415639_038398 | 3300038395 | Bacteria | 5131 |
| 280 | Ga0415639_052117 | 3300038395 | Bacteria | 5823 |
| 281 | Ga0466690_100903 | 3300042590 | Unclassified | 3473 |
| 282 | Ga0466690_110527 | 3300042590 | Bacteria | 7398 |
| 283 | Ga0466692_035804 | 3300042591 | Bacteria | 1832 |
| 284 | Ga0466692_105609 | 3300042591 | Bacteria | 14269 |
| 285 | Ga0466692_121077 | 3300042591 | Bacteria | 3169 |
| 286 | Ga0466692_167901 | 3300042591 | Unclassified | 1175 |
| 287 | Ga0466693_279320 | 3300042592 | Bacteria | 20627 |
| 288 | Ga0466691_020887 | 3300042593 | Bacteria | 13836 |
| 289 | Ga0466695_154361 | 3300042595 | Bacteria | 1351 |
| 290 | Ga0466699_173544 | 3300042597 | Bacteria | 12684 |
| 291 | Ga0466701_035736 | 3300042598 | Bacteria | 2041 |
| 292 | Ga0466700_451957 | 3300042600 | Unclassified | 2469 |
| 293 | Ga0466707_002386 | 3300042601 | Bacteria | 1704 |
| 294 | Ga0466707_328035 | 3300042601 | Bacteria | 1539 |
| 295 | Ga0466707_379823 | 3300042601 | Bacteria | 13752 |
| 296 | Ga0466713_117127 | 3300042602 | Unclassified | 16638 |
| 297 | Ga0466717_023347 | 3300042604 | Bacteria | 1291 |
| 298 | Ga0466720_023009 | 3300042607 | Bacteria | 3386 |
| 299 | Ga0466722_093580 | 3300042609 | Bacteria | 8041 |
| 300 | Ga0466735_047155 | 3300042624 | Bacteria | 4967 |
| 301 | Ga0466702_267521 | 3300042635 | Bacteria | 1911 |
| 302 | Ga0466703_247878 | 3300042636 | Bacteria | 13092 |
| 303 | Ga0466703_256443 | 3300042636 | Bacteria | 11097 |
| 304 | Ga0466703_271320 | 3300042636 | Bacteria | 21340 |
| 305 | Ga0466703_278279 | 3300042636 | Bacteria | 2190 |
| 306 | Ga0466704_363605 | 3300042643 | Bacteria | 11317 |
| 307 | Ga0466704_540541 | 3300042643 | Unclassified | 5464 |
| 308 | Ga0466709_032120 | 3300042648 | Bacteria | 4675 |
| 309 | Ga0466709_070696 | 3300042648 | Bacteria | 17498 |
| 310 | Ga0466727_283617 | 3300042655 | Bacteria | 2734 |
| 311 | Ga0123357_10131527 | 3300009784 | Unclassified | 3113 |
| 312 | Ga0123355_10487169 | 3300009826 | Bacteria | 1530 |
| 313 | Ga0123356_10012770 | 3300010049 | Bacteria | 8132 |
| 314 | Ga0123353_10283437 | 3300010167 | Bacteria | 2542 |
| 315 | Ga0123353_10285969 | 3300010167 | Bacteria | 2528 |
| 316 | Ga0123353_10707845 | 3300010167 | Bacteria | 1412 |
| 317 | Ga0123354_10209678 | 3300010882 | Bacteria | 2110 |
| 318 | Ga0160466_107663 | 3300012809 | Unclassified | 1257 |
| 319 | AustNasuHG_c1003168 | 3300000089 | Bacteria | 5935 |
| 320 | JGI24698J34947_10040332 | 3300002449 | Unclassified | 2411 |
| 321 | JGI24698J34947_10052286 | 3300002449 | Unclassified | 2051 |
| 322 | JGI24698J34947_10065316 | 3300002449 | Bacteria | 1774 |
| 323 | JGI24695J34938_10003348 | 3300002450 | Bacteria | 11275 |
| 324 | JGI24695J34938_10006049 | 3300002450 | Bacteria | 7373 |
| 325 | JGI24695J34938_10007018 | 3300002450 | Bacteria | 6674 |
| 326 | JGI24695J34938_10015378 | 3300002450 | Bacteria | 3928 |
| 327 | JGI24702J35022_10156840 | 3300002462 | Bacteria | 1280 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07726 | AAA_3 | ATPase family associated with various cellular activities (AAA) | 62 | 192 | 1 |
| PF17863 | AAA_lid_2 | AAA lid domain | 260 | 329 | 0.95 |
| PF07728 | AAA_5 | AAA domain (dynein-related subfamily) | 62 | 190 | 0.92 |
| PF20030 | bpMoxR | MoxR domain in the MoxR-vWA-beta-propeller ternary systems | 31 | 198 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.