Protein Family IF07614
Metagenome
Isolate
227
Members
49
Samples
217
Scaffolds
210.44
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_029652|Ga0466715_029652_3675_4400
- Length
- 208 aa
- Sequence
- MKLFFHYCLFGFSNCYILGSDFPGEDASLAAIIIDPGSMDEEILDFIEENEYTLRGILVTHDHRNHVHGLRTIKRIYDAADIYGVNHSILDHKTNVVRDGDVLNLGPFRIEVISVPGHSADSAVYRVEHFLFTGDVLSAGLVGSTASSYGAAVQMTALRSKILSIQGDIVVLPGHGPPSCLEAERRFNPGILCYDQNKNQRPAFSAEI
Sample Types
Isolate
4.4%
Metagenome
95.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.2%
Kalotermitidae
29.2%
Unclassified
20.8%
Rhinotermitidae
8.3%
Termopsidae
6.2%
Hodotermitidae
2.1%
Blaberidae
2.1%
Taxonomy
Archaea
0
Bacteria
218
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 30 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 31 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 32 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 33 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 34 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 48 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 49 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_053880 | 3300042612 | Bacteria | 18203 |
| 2 | Ga0466705_101831 | 3300042612 | Bacteria | 2388 |
| 3 | Ga0466694_079311 | 3300042594 | Bacteria | 2737 |
| 4 | Ga0123353_10516522 | 3300010167 | Bacteria | 1735 |
| 5 | Ga0466729_203271 | 3300042621 | Bacteria | 1123 |
| 6 | Ga0466729_263625 | 3300042621 | Bacteria | 1173 |
| 7 | Ga0466729_316965 | 3300042621 | Bacteria | 1724 |
| 8 | Ga0466703_025216 | 3300042636 | Bacteria | 7777 |
| 9 | Ga0466703_066553 | 3300042636 | Unclassified | 2398 |
| 10 | Ga0466703_331797 | 3300042636 | Bacteria | 6705 |
| 11 | Ga0466704_008344 | 3300042643 | Bacteria | 2165 |
| 12 | Ga0466709_173265 | 3300042648 | Bacteria | 2327 |
| 13 | Ga0466727_130840 | 3300042655 | Bacteria | 1893 |
| 14 | Ga0466700_093691 | 3300042600 | Bacteria | 1775 |
| 15 | Ga0466716_497886 | 3300042605 | Bacteria | 1369 |
| 16 | Ga0466719_511534 | 3300042606 | Unclassified | 1175 |
| 17 | Ga0466719_548779 | 3300042606 | Bacteria | 6196 |
| 18 | Ga0466719_569191 | 3300042606 | Bacteria | 1959 |
| 19 | Ga0466722_093178 | 3300042609 | Bacteria | 1872 |
| 20 | JGI24698J34947_10009071 | 3300002449 | Bacteria | 5457 |
| 21 | JGI24698J34947_10045989 | 3300002449 | Bacteria | 2223 |
| 22 | Ga0072941_1003850 | 3300005201 | Bacteria | 7474 |
| 23 | Ga0466711_288961 | 3300042615 | Bacteria | 16592 |
| 24 | Ga0466711_510608 | 3300042615 | Bacteria | 1807 |
| 25 | Ga0466715_072653 | 3300042616 | Bacteria | 9131 |
| 26 | Ga0466715_085939 | 3300042616 | Bacteria | 16172 |
| 27 | Ga0466715_205057 | 3300042616 | Bacteria | 2726 |
| 28 | Ga0466728_178791 | 3300042620 | Bacteria | 5796 |
| 29 | Ga0466729_150082 | 3300042621 | Bacteria | 2261 |
| 30 | Ga0466705_266022 | 3300042612 | Bacteria | 4344 |
| 31 | Ga0466691_198100 | 3300042593 | Bacteria | 1617 |
| 32 | Ga0466699_024517 | 3300042597 | Bacteria | 2493 |
| 33 | Ga0123356_10651525 | 3300010049 | Bacteria | 1220 |
| 34 | Ga0466703_159265 | 3300042636 | Bacteria | 3610 |
| 35 | Ga0466703_338676 | 3300042636 | Bacteria | 7899 |
| 36 | Ga0466703_366473 | 3300042636 | Bacteria | 21219 |
| 37 | Ga0466704_111326 | 3300042643 | Bacteria | 7052 |
| 38 | Ga0466704_263812 | 3300042643 | Bacteria | 2207 |
| 39 | Ga0466708_175268 | 3300042652 | Bacteria | 1580 |
| 40 | Ga0466708_334356 | 3300042652 | Bacteria | 4289 |
| 41 | Ga0466727_129752 | 3300042655 | Bacteria | 2468 |
| 42 | Ga0466707_000504 | 3300042601 | Bacteria | 2719 |
| 43 | Ga0466707_092497 | 3300042601 | Bacteria | 1106 |
| 44 | Ga0466707_336601 | 3300042601 | Bacteria | 1016 |
| 45 | Ga0466707_409010 | 3300042601 | Bacteria | 1350 |
| 46 | Ga0466719_167098 | 3300042606 | Bacteria | 38069 |
| 47 | Ga0466722_094211 | 3300042609 | Bacteria | 1491 |
| 48 | JGI24702J35022_10000901 | 3300002462 | Bacteria | 18491 |
| 49 | Ga0466711_355470 | 3300042615 | Bacteria | 1207 |
| 50 | Ga0466715_090565 | 3300042616 | Bacteria | 13946 |
| 51 | Ga0466715_232246 | 3300042616 | Bacteria | 4113 |
| 52 | Ga0466723_329003 | 3300042618 | Bacteria | 8607 |
| 53 | Ga0466726_446691 | 3300042619 | Bacteria | 1355 |
| 54 | Ga0466733_003904 | 3300042659 | Bacteria | 41210 |
| 55 | Ga0466733_082519 | 3300042659 | Bacteria | 1989 |
| 56 | Ga0466690_090273 | 3300042590 | Bacteria | 3002 |
| 57 | Ga0466690_159612 | 3300042590 | Bacteria | 15265 |
| 58 | Ga0466692_155604 | 3300042591 | Bacteria | 2892 |
| 59 | Ga0466696_103719 | 3300042596 | Bacteria | 7451 |
| 60 | Ga0466696_457562 | 3300042596 | Bacteria | 1765 |
| 61 | Ga0123353_10048813 | 3300010167 | Bacteria | 6742 |
| 62 | Ga0466729_297625 | 3300042621 | Bacteria | 1369 |
| 63 | Ga0466703_029282 | 3300042636 | Bacteria | 10441 |
| 64 | Ga0466703_071054 | 3300042636 | Bacteria | 10787 |
| 65 | Ga0466703_225562 | 3300042636 | Bacteria | 5713 |
| 66 | Ga0466704_097732 | 3300042643 | Bacteria | 11239 |
| 67 | Ga0466704_202407 | 3300042643 | Bacteria | 10285 |
| 68 | Ga0466704_504366 | 3300042643 | Bacteria | 5464 |
| 69 | Ga0466708_005781 | 3300042652 | Bacteria | 36777 |
| 70 | Ga0466708_369101 | 3300042652 | Bacteria | 1878 |
| 71 | Ga0466707_081252 | 3300042601 | Bacteria | 2088 |
| 72 | Ga0466716_085280 | 3300042605 | Bacteria | 5510 |
| 73 | Ga0466716_140376 | 3300042605 | Bacteria | 16825 |
| 74 | Ga0466716_142568 | 3300042605 | Bacteria | 11917 |
| 75 | Ga0466719_337134 | 3300042606 | Bacteria | 3224 |
| 76 | Ga0466719_452615 | 3300042606 | Bacteria | 20917 |
| 77 | Ga0466719_519214 | 3300042606 | Bacteria | 1551 |
| 78 | JGI24705J35276_11829780 | 3300002504 | Bacteria | 702 |
| 79 | JGI24699J35502_11132010 | 3300002509 | Unclassified | 6273 |
| 80 | Ga0466711_108740 | 3300042615 | Bacteria | 5393 |
| 81 | Ga0466715_222045 | 3300042616 | Bacteria | 16267 |
| 82 | Ga0466715_348294 | 3300042616 | Bacteria | 8924 |
| 83 | Ga0466723_057409 | 3300042618 | Bacteria | 7670 |
| 84 | Ga0466723_114352 | 3300042618 | Bacteria | 10350 |
| 85 | Ga0466728_120403 | 3300042620 | Bacteria | 3768 |
| 86 | Ga0466705_099836 | 3300042612 | Bacteria | 8888 |
| 87 | Ga0466733_181454 | 3300042659 | Bacteria | 2381 |
| 88 | Ga0466690_073315 | 3300042590 | Bacteria | 3679 |
| 89 | Ga0466690_374422 | 3300042590 | Bacteria | 4743 |
| 90 | Ga0466694_175066 | 3300042594 | Bacteria | 19070 |
| 91 | Ga0466696_104661 | 3300042596 | Bacteria | 2358 |
| 92 | Ga0466696_351977 | 3300042596 | Bacteria | 4899 |
| 93 | Ga0466696_402809 | 3300042596 | Bacteria | 1435 |
| 94 | Ga0466704_132457 | 3300042643 | Bacteria | 10555 |
| 95 | Ga0466709_344563 | 3300042648 | Bacteria | 15197 |
| 96 | Ga0466708_263468 | 3300042652 | Bacteria | 41501 |
| 97 | Ga0466707_117708 | 3300042601 | Bacteria | 1118 |
| 98 | Ga0466719_114780 | 3300042606 | Bacteria | 2788 |
| 99 | Ga0466719_138397 | 3300042606 | Unclassified | 4869 |
| 100 | Ga0466719_204902 | 3300042606 | Bacteria | 7393 |
| 101 | Ga0466711_390002 | 3300042615 | Bacteria | 14288 |
| 102 | Ga0466715_094778 | 3300042616 | Bacteria | 3489 |
| 103 | Ga0466715_113224 | 3300042616 | Bacteria | 18533 |
| 104 | Ga0466715_168360 | 3300042616 | Bacteria | 1645 |
| 105 | Ga0466723_231803 | 3300042618 | Bacteria | 1082 |
| 106 | Ga0466726_141578 | 3300042619 | Unclassified | 2297 |
| 107 | Ga0466726_147985 | 3300042619 | Bacteria | 1880 |
| 108 | Ga0466728_128128 | 3300042620 | Bacteria | 4416 |
| 109 | Ga0466705_157964 | 3300042612 | Bacteria | 4846 |
| 110 | Ga0466705_329623 | 3300042612 | Unclassified | 6480 |
| 111 | Ga0466705_367644 | 3300042612 | Bacteria | 4725 |
| 112 | Ga0466691_034404 | 3300042593 | Unclassified | 3799 |
| 113 | Ga0466691_113163 | 3300042593 | Bacteria | 6040 |
| 114 | Ga0466694_033406 | 3300042594 | Bacteria | 2180 |
| 115 | Ga0466696_036964 | 3300042596 | Bacteria | 6133 |
| 116 | Ga0466699_211877 | 3300042597 | Bacteria | 1647 |
| 117 | Ga0466735_030739 | 3300042624 | Bacteria | 31656 |
| 118 | Ga0466727_240366 | 3300042655 | Bacteria | 2465 |
| 119 | Ga0466707_340746 | 3300042601 | Bacteria | 2093 |
| 120 | Ga0466716_199677 | 3300042605 | Bacteria | 2515 |
| 121 | Ga0466716_446072 | 3300042605 | Bacteria | 4393 |
| 122 | Ga0466722_004952 | 3300042609 | Bacteria | 2779 |
| 123 | JGI24695J34938_10001247 | 3300002450 | Bacteria | 22361 |
| 124 | JGI24705J35276_11898354 | 3300002504 | Bacteria | 749 |
| 125 | Ga0466715_051661 | 3300042616 | Bacteria | 2943 |
| 126 | Ga0466715_316091 | 3300042616 | Bacteria | 7715 |
| 127 | Ga0466726_183584 | 3300042619 | Bacteria | 1852 |
| 128 | Ga0466726_243472 | 3300042619 | Bacteria | 1547 |
| 129 | Ga0466729_078422 | 3300042621 | Bacteria | 2202 |
| 130 | Ga0466729_113448 | 3300042621 | Bacteria | 9606 |
| 131 | Ga0466729_193436 | 3300042621 | Bacteria | 4363 |
| 132 | Ga0466733_117691 | 3300042659 | Bacteria | 3652 |
| 133 | Ga0466690_178522 | 3300042590 | Unclassified | 1644 |
| 134 | Ga0466696_080074 | 3300042596 | Bacteria | 8789 |
| 135 | Ga0466696_083130 | 3300042596 | Bacteria | 1230 |
| 136 | Ga0123353_10415283 | 3300010167 | Bacteria | 1996 |
| 137 | Ga0466735_093843 | 3300042624 | Bacteria | 1791 |
| 138 | Ga0466703_303301 | 3300042636 | Bacteria | 9365 |
| 139 | Ga0466704_448092 | 3300042643 | Bacteria | 3683 |
| 140 | Ga0466709_112857 | 3300042648 | Bacteria | 5205 |
| 141 | Ga0466708_106622 | 3300042652 | Bacteria | 1362 |
| 142 | Ga0466708_141813 | 3300042652 | Bacteria | 5093 |
| 143 | Ga0466708_223813 | 3300042652 | Bacteria | 2336 |
| 144 | Ga0466727_054471 | 3300042655 | Bacteria | 6302 |
| 145 | Ga0466716_306822 | 3300042605 | Bacteria | 5122 |
| 146 | Ga0072941_1001686 | 3300005201 | Bacteria | 32962 |
| 147 | Ga0466711_198709 | 3300042615 | Bacteria | 4968 |
| 148 | Ga0466711_411560 | 3300042615 | Bacteria | 21637 |
| 149 | Ga0466715_078706 | 3300042616 | Bacteria | 1926 |
| 150 | Ga0466723_091237 | 3300042618 | Bacteria | 4723 |
| 151 | Ga0466726_329685 | 3300042619 | Bacteria | 1165 |
| 152 | Ga0466726_390264 | 3300042619 | Bacteria | 1317 |
| 153 | Ga0466733_042823 | 3300042659 | Bacteria | 8554 |
| 154 | Ga0466696_011775 | 3300042596 | Bacteria | 4478 |
| 155 | Ga0466696_190385 | 3300042596 | Bacteria | 26854 |
| 156 | Ga0123356_10000823 | 3300010049 | Bacteria | 34466 |
| 157 | Ga0466735_006338 | 3300042624 | Bacteria | 2515 |
| 158 | Ga0466735_037539 | 3300042624 | Bacteria | 2739 |
| 159 | Ga0466735_054586 | 3300042624 | Bacteria | 2150 |
| 160 | Ga0466703_000104 | 3300042636 | Bacteria | 4328 |
| 161 | Ga0466704_076773 | 3300042643 | Bacteria | 1068 |
| 162 | Ga0466709_002685 | 3300042648 | Bacteria | 1928 |
| 163 | Ga0466709_192733 | 3300042648 | Bacteria | 11921 |
| 164 | Ga0466708_020056 | 3300042652 | Bacteria | 11627 |
| 165 | Ga0466708_162467 | 3300042652 | Bacteria | 15143 |
| 166 | Ga0466708_217334 | 3300042652 | Bacteria | 8288 |
| 167 | Ga0466708_255101 | 3300042652 | Bacteria | 1120 |
| 168 | Ga0466727_136040 | 3300042655 | Bacteria | 2534 |
| 169 | Ga0466727_236488 | 3300042655 | Bacteria | 2980 |
| 170 | Ga0466707_007416 | 3300042601 | Bacteria | 1409 |
| 171 | Ga0466707_170811 | 3300042601 | Bacteria | 1437 |
| 172 | Ga0466722_268725 | 3300042609 | Bacteria | 7075 |
| 173 | Ga0466698_451299 | 3300042610 | Bacteria | 1030 |
| 174 | JGI24698J34947_10119142 | 3300002449 | Bacteria | 1149 |
| 175 | JGI24702J35022_10007805 | 3300002462 | Bacteria | 6103 |
| 176 | Ga0072941_1001690 | 3300005201 | Bacteria | 1253 |
| 177 | Ga0072941_1066960 | 3300005201 | Bacteria | 4413 |
| 178 | Ga0466715_029652 | 3300042616 | Bacteria | 18359 |
| 179 | Ga0466718_085500 | 3300042617 | Bacteria | 9947 |
| 180 | Ga0466723_090376 | 3300042618 | Bacteria | 1935 |
| 181 | Ga0466723_110581 | 3300042618 | Bacteria | 10618 |
| 182 | Ga0466723_232250 | 3300042618 | Bacteria | 17224 |
| 183 | Ga0466723_350198 | 3300042618 | Bacteria | 4612 |
| 184 | Ga0466726_244690 | 3300042619 | Bacteria | 1587 |
| 185 | Ga0466728_354232 | 3300042620 | Bacteria | 4020 |
| 186 | Ga0466729_191543 | 3300042621 | Bacteria | 2919 |
| 187 | Ga0466733_118076 | 3300042659 | Unclassified | 1562 |
| 188 | Ga0456237_0009143 | 3300041968 | Bacteria | 1481 |
| 189 | Ga0466690_029239 | 3300042590 | Bacteria | 1999 |
| 190 | Ga0123357_10022271 | 3300009784 | Bacteria | 8490 |
| 191 | Ga0123353_10208718 | 3300010167 | Bacteria | 3065 |
| 192 | Ga0123353_10459828 | 3300010167 | Bacteria | 1871 |
| 193 | Ga0123353_12016235 | 3300010167 | Bacteria | 706 |
| 194 | Ga0123354_10140226 | 3300010882 | Bacteria | 2996 |
| 195 | Ga0123354_10328367 | 3300010882 | Bacteria | 1399 |
| 196 | Ga0466704_098768 | 3300042643 | Bacteria | 1929 |
| 197 | Ga0466709_323273 | 3300042648 | Bacteria | 3974 |
| 198 | Ga0466709_382506 | 3300042648 | Bacteria | 18808 |
| 199 | Ga0466708_129937 | 3300042652 | Bacteria | 1461 |
| 200 | Ga0466708_135027 | 3300042652 | Bacteria | 43391 |
| 201 | Ga0466708_339681 | 3300042652 | Bacteria | 11941 |
| 202 | Ga0466706_254423 | 3300042599 | Bacteria | 1556 |
| 203 | Ga0466716_521386 | 3300042605 | Bacteria | 3740 |
| 204 | Ga0466719_294202 | 3300042606 | Bacteria | 4079 |
| 205 | Ga0466722_094121 | 3300042609 | Bacteria | 4560 |
| 206 | Ga0466711_202790 | 3300042615 | Bacteria | 1597 |
| 207 | Ga0466711_278707 | 3300042615 | Bacteria | 8725 |
| 208 | Ga0466711_381411 | 3300042615 | Bacteria | 37207 |
| 209 | Ga0466715_196183 | 3300042616 | Bacteria | 15710 |
| 210 | Ga0466715_249703 | 3300042616 | Bacteria | 5161 |
| 211 | Ga0466715_368424 | 3300042616 | Bacteria | 3830 |
| 212 | Ga0466723_017240 | 3300042618 | Bacteria | 2899 |
| 213 | Ga0466726_476085 | 3300042619 | Bacteria | 2282 |
| 214 | Ga0466728_038366 | 3300042620 | Bacteria | 11491 |
| 215 | Ga0466728_203975 | 3300042620 | Bacteria | 2304 |
| 216 | Ga0466728_421319 | 3300042620 | Bacteria | 1981 |
| 217 | Ga0466729_042171 | 3300042621 | Bacteria | 1565 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00753 | Lactamase_B | Metallo-beta-lactamase superfamily | 11 | 175 | 0.75 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.