Protein Family IF07588
Metagenome
Isolate
187
Members
53
Samples
175
Scaffolds
286.49
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_497748|Ga0466711_497748_3939_4937
- Length
- 332 aa
- Sequence
- MSIQKLSLYTIANLKYIISMFIQSVNKNLKNIYISFERVYTVFMVRIGLRAHDYGRLPPGDLAGVIASYGVESVQLALSKALPGAPGPGSLSPGYARAVCRAFEAKGINIAVLGCYINPVHPDRDERERGLALFEEHLRFAGDFGCSVVGTETGSRDPGGSYHPDTVKGETFDTLCFSMERILKTAEKCGSVAGIEAVADRHTISSVGLMEKLIEKFPSPALGIIYDPVNLIPEGGLSRGQEAFFKEALDCLGSRIMAVHLKDFRMRDGKKEGDLPAGTGELDWFRLLKLLMEKKPGVDLLLENSGPSTGRGIITFLRELAVKIIDKKNKEL
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.3%
Kalotermitidae
27.5%
Unclassified
21.6%
Rhinotermitidae
7.8%
Termopsidae
3.9%
Blaberidae
2.0%
Taxonomy
Archaea
0
Bacteria
170
Eukaryota
0
Viruses
1
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 11 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 12 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 32 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 41 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 44 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 49 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10533672 | 3300010167 | Bacteria | 1698 |
| 2 | Ga0123353_10794371 | 3300010167 | Bacteria | 1308 |
| 3 | JGI24698J34947_10044620 | 3300002449 | Bacteria | 2267 |
| 4 | JGI24695J34938_10000187 | 3300002450 | Bacteria | 58138 |
| 5 | JGI24695J34938_10002735 | 3300002450 | Bacteria | 12972 |
| 6 | JGI24695J34938_10006769 | 3300002450 | Bacteria | 6813 |
| 7 | Ga0466705_070734 | 3300042612 | Bacteria | 1378 |
| 8 | Ga0466705_136640 | 3300042612 | Bacteria | 3484 |
| 9 | Ga0466704_191702 | 3300042643 | Unclassified | 4788 |
| 10 | Ga0466708_032598 | 3300042652 | Bacteria | 6918 |
| 11 | Ga0466708_167668 | 3300042652 | Viruses | 3982 |
| 12 | Ga0415639_033452 | 3300038395 | Bacteria | 8222 |
| 13 | Ga0466690_239732 | 3300042590 | Bacteria | 1172 |
| 14 | Ga0466692_181806 | 3300042591 | Bacteria | 2834 |
| 15 | Ga0466696_436396 | 3300042596 | Bacteria | 8356 |
| 16 | Ga0466714_007289 | 3300042603 | Bacteria | 3482 |
| 17 | Ga0466722_061893 | 3300042609 | Bacteria | 19849 |
| 18 | Ga0466711_357896 | 3300042615 | Bacteria | 2787 |
| 19 | Ga0466718_041388 | 3300042617 | Bacteria | 8867 |
| 20 | Ga0466723_227830 | 3300042618 | Bacteria | 21601 |
| 21 | Ga0466723_352961 | 3300042618 | Bacteria | 4359 |
| 22 | Ga0466728_244014 | 3300042620 | Bacteria | 12713 |
| 23 | Ga0123356_10000882 | 3300010049 | Bacteria | 33318 |
| 24 | JGI24698J34947_10030862 | 3300002449 | Bacteria | 2824 |
| 25 | JGI24695J34938_10009771 | 3300002450 | Bacteria | 5310 |
| 26 | Ga0466729_276301 | 3300042621 | Unclassified | 1161 |
| 27 | Ga0466704_242779 | 3300042643 | Bacteria | 6435 |
| 28 | Ga0466690_142920 | 3300042590 | Bacteria | 26948 |
| 29 | Ga0466696_110638 | 3300042596 | Bacteria | 39746 |
| 30 | Ga0466716_094023 | 3300042605 | Bacteria | 4338 |
| 31 | Ga0466719_213718 | 3300042606 | Bacteria | 6610 |
| 32 | Ga0466720_198909 | 3300042607 | Bacteria | 5460 |
| 33 | Ga0466722_012107 | 3300042609 | Bacteria | 8836 |
| 34 | Ga0466722_078662 | 3300042609 | Bacteria | 2103 |
| 35 | Ga0466712_093979 | 3300042614 | Bacteria | 10428 |
| 36 | Ga0466718_033135 | 3300042617 | Bacteria | 11508 |
| 37 | Ga0466718_165710 | 3300042617 | Bacteria | 10579 |
| 38 | Ga0466723_006055 | 3300042618 | Bacteria | 37836 |
| 39 | Ga0466733_208167 | 3300042659 | Bacteria | 31218 |
| 40 | Ga0123355_10660595 | 3300009826 | Bacteria | 1216 |
| 41 | Ga0123356_10160996 | 3300010049 | Bacteria | 2242 |
| 42 | Ga0123354_10115160 | 3300010882 | Bacteria | 3516 |
| 43 | JGI24695J34938_10001509 | 3300002450 | Bacteria | 19637 |
| 44 | JGI24695J34938_10035738 | 3300002450 | Bacteria | 2270 |
| 45 | Ga0072941_1044629 | 3300005201 | Bacteria | 7255 |
| 46 | Ga0466705_075668 | 3300042612 | Bacteria | 3632 |
| 47 | Ga0466705_131276 | 3300042612 | Bacteria | 6972 |
| 48 | Ga0264413_101525 | 3300024493 | Bacteria | 9553 |
| 49 | Ga0264413_106533 | 3300024493 | Bacteria | 4146 |
| 50 | Ga0415639_105101 | 3300038395 | Bacteria | 1863 |
| 51 | Ga0456237_0012039 | 3300041968 | Unclassified | 1256 |
| 52 | Ga0466692_164894 | 3300042591 | Bacteria | 3918 |
| 53 | Ga0466696_018189 | 3300042596 | Unclassified | 1041 |
| 54 | Ga0466696_447338 | 3300042596 | Bacteria | 1437 |
| 55 | Ga0466699_164087 | 3300042597 | Bacteria | 3131 |
| 56 | Ga0466712_060769 | 3300042614 | Bacteria | 7376 |
| 57 | Ga0466723_293823 | 3300042618 | Bacteria | 10602 |
| 58 | Ga0466728_032851 | 3300042620 | Bacteria | 4394 |
| 59 | Ga0466728_147722 | 3300042620 | Bacteria | 1813 |
| 60 | Ga0123356_10040698 | 3300010049 | Bacteria | 4330 |
| 61 | Ga0123356_10558163 | 3300010049 | Bacteria | 1307 |
| 62 | JGI24698J34947_10009033 | 3300002449 | Bacteria | 5468 |
| 63 | JGI24695J34938_10000542 | 3300002450 | Bacteria | 36534 |
| 64 | JGI24695J34938_10004228 | 3300002450 | Unclassified | 9534 |
| 65 | JGI24695J34938_10030220 | 3300002450 | Bacteria | 2524 |
| 66 | Ga0466705_101116 | 3300042612 | Bacteria | 4609 |
| 67 | Ga0466729_265262 | 3300042621 | Bacteria | 1757 |
| 68 | Ga0466729_265795 | 3300042621 | Bacteria | 1507 |
| 69 | Ga0466735_136128 | 3300042624 | Bacteria | 1062 |
| 70 | Ga0466704_400575 | 3300042643 | Bacteria | 7240 |
| 71 | Ga0466709_116420 | 3300042648 | Bacteria | 23667 |
| 72 | Ga0264413_137793 | 3300024493 | Bacteria | 1657 |
| 73 | Ga0466691_077378 | 3300042593 | Bacteria | 2917 |
| 74 | Ga0466691_091969 | 3300042593 | Bacteria | 5672 |
| 75 | Ga0466696_143642 | 3300042596 | Bacteria | 4221 |
| 76 | Ga0466707_352723 | 3300042601 | Bacteria | 2168 |
| 77 | Ga0466707_377706 | 3300042601 | Unclassified | 17518 |
| 78 | Ga0466720_065144 | 3300042607 | Unclassified | 1191 |
| 79 | Ga0466721_012441 | 3300042608 | Bacteria | 32907 |
| 80 | Ga0466722_050211 | 3300042609 | Bacteria | 8070 |
| 81 | Ga0466722_184712 | 3300042609 | Bacteria | 7311 |
| 82 | Ga0466722_249761 | 3300042609 | Bacteria | 1600 |
| 83 | Ga0466711_017022 | 3300042615 | Bacteria | 7619 |
| 84 | Ga0466711_467368 | 3300042615 | Bacteria | 4586 |
| 85 | Ga0466711_497748 | 3300042615 | Bacteria | 6656 |
| 86 | Ga0466715_195283 | 3300042616 | Bacteria | 8912 |
| 87 | Ga0466726_266634 | 3300042619 | Bacteria | 1512 |
| 88 | JGI24698J34947_10028931 | 3300002449 | Bacteria | 2932 |
| 89 | JGI24702J35022_10006174 | 3300002462 | Bacteria | 6946 |
| 90 | Ga0072941_1159663 | 3300005201 | Bacteria | 1708 |
| 91 | Ga0466705_115130 | 3300042612 | Unclassified | 1370 |
| 92 | Ga0466705_305750 | 3300042612 | Bacteria | 2495 |
| 93 | Ga0466705_349783 | 3300042612 | Bacteria | 9907 |
| 94 | Ga0466703_108432 | 3300042636 | Bacteria | 15782 |
| 95 | Ga0466703_343396 | 3300042636 | Bacteria | 8440 |
| 96 | Ga0466708_043183 | 3300042652 | Bacteria | 3712 |
| 97 | Ga0466696_080624 | 3300042596 | Bacteria | 13219 |
| 98 | Ga0466700_335946 | 3300042600 | Bacteria | 1142 |
| 99 | Ga0466700_432334 | 3300042600 | Unclassified | 1100 |
| 100 | Ga0466722_071720 | 3300042609 | Bacteria | 2428 |
| 101 | Ga0466722_215003 | 3300042609 | Bacteria | 14562 |
| 102 | Ga0466715_045787 | 3300042616 | Bacteria | 4836 |
| 103 | Ga0466715_434613 | 3300042616 | Bacteria | 1606 |
| 104 | Ga0466726_053647 | 3300042619 | Bacteria | 4444 |
| 105 | Ga0466732_263879 | 3300042656 | Bacteria | 1041 |
| 106 | Ga0123356_10000116 | 3300010049 | Bacteria | 86622 |
| 107 | Ga0123356_10315382 | 3300010049 | Bacteria | 1674 |
| 108 | Ga0466705_174735 | 3300042612 | Unclassified | 1656 |
| 109 | Ga0466705_202727 | 3300042612 | Bacteria | 8426 |
| 110 | Ga0466709_330481 | 3300042648 | Bacteria | 4522 |
| 111 | Ga0466708_205225 | 3300042652 | Bacteria | 4892 |
| 112 | Ga0466692_189215 | 3300042591 | Bacteria | 7065 |
| 113 | Ga0466693_325062 | 3300042592 | Bacteria | 1941 |
| 114 | Ga0466719_205646 | 3300042606 | Unclassified | 1621 |
| 115 | Ga0466719_334426 | 3300042606 | Bacteria | 2466 |
| 116 | Ga0466722_174001 | 3300042609 | Bacteria | 2593 |
| 117 | Ga0466722_176634 | 3300042609 | Bacteria | 1070 |
| 118 | Ga0466715_635732 | 3300042616 | Bacteria | 2338 |
| 119 | Ga0466723_174875 | 3300042618 | Bacteria | 8764 |
| 120 | Ga0466726_357244 | 3300042619 | Bacteria | 4206 |
| 121 | Ga0466728_079737 | 3300042620 | Bacteria | 3424 |
| 122 | Ga0123356_10012737 | 3300010049 | Bacteria | 8145 |
| 123 | Ga0466705_182986 | 3300042612 | Bacteria | 5958 |
| 124 | Ga0466735_129594 | 3300042624 | Bacteria | 4481 |
| 125 | Ga0466703_264258 | 3300042636 | Bacteria | 1323 |
| 126 | Ga0466704_063772 | 3300042643 | Bacteria | 8680 |
| 127 | Ga0466704_249234 | 3300042643 | Bacteria | 26787 |
| 128 | Ga0466704_434890 | 3300042643 | Bacteria | 41687 |
| 129 | Ga0466709_418088 | 3300042648 | Bacteria | 6821 |
| 130 | Ga0466708_029746 | 3300042652 | Bacteria | 8047 |
| 131 | Ga0456237_0002209 | 3300041968 | Unclassified | 3146 |
| 132 | Ga0466692_077638 | 3300042591 | Bacteria | 3237 |
| 133 | Ga0466693_164323 | 3300042592 | Bacteria | 14525 |
| 134 | Ga0466691_068163 | 3300042593 | Bacteria | 25189 |
| 135 | Ga0466694_359015 | 3300042594 | Bacteria | 1597 |
| 136 | Ga0466714_143322 | 3300042603 | Bacteria | 1204 |
| 137 | Ga0466716_158424 | 3300042605 | Bacteria | 38563 |
| 138 | Ga0466719_297251 | 3300042606 | Bacteria | 8240 |
| 139 | Ga0466720_018543 | 3300042607 | Bacteria | 131979 |
| 140 | Ga0466720_120731 | 3300042607 | Bacteria | 11825 |
| 141 | Ga0466720_142959 | 3300042607 | Bacteria | 4301 |
| 142 | Ga0466722_023939 | 3300042609 | Bacteria | 17671 |
| 143 | Ga0466715_062814 | 3300042616 | Bacteria | 8457 |
| 144 | Ga0466715_534205 | 3300042616 | Bacteria | 3808 |
| 145 | Ga0466718_064809 | 3300042617 | Bacteria | 1272 |
| 146 | Ga0123355_10332720 | 3300009826 | Bacteria | 2032 |
| 147 | Ga0123356_10004273 | 3300010049 | Bacteria | 14779 |
| 148 | Ga0123356_10363756 | 3300010049 | Bacteria | 1574 |
| 149 | JGI24695J34938_10000852 | 3300002450 | Bacteria | 28276 |
| 150 | JGI24695J34938_10042784 | 3300002450 | Bacteria | 2024 |
| 151 | Ga0072941_1043635 | 3300005201 | Bacteria | 5943 |
| 152 | Ga0466705_004457 | 3300042612 | Bacteria | 2446 |
| 153 | Ga0466705_017686 | 3300042612 | Bacteria | 14745 |
| 154 | Ga0466705_126222 | 3300042612 | Bacteria | 8501 |
| 155 | Ga0466735_065939 | 3300042624 | Bacteria | 2435 |
| 156 | Ga0466735_228179 | 3300042624 | Bacteria | 7072 |
| 157 | Ga0466703_176867 | 3300042636 | Bacteria | 18347 |
| 158 | Ga0466704_218742 | 3300042643 | Unclassified | 2264 |
| 159 | Ga0466709_216335 | 3300042648 | Bacteria | 4220 |
| 160 | Ga0466708_069435 | 3300042652 | Unclassified | 1822 |
| 161 | Ga0466708_366461 | 3300042652 | Bacteria | 4196 |
| 162 | Ga0466690_001469 | 3300042590 | Bacteria | 4487 |
| 163 | Ga0466690_313101 | 3300042590 | Bacteria | 15147 |
| 164 | Ga0466691_079092 | 3300042593 | Bacteria | 17061 |
| 165 | Ga0466694_039042 | 3300042594 | Bacteria | 1511 |
| 166 | Ga0466699_046187 | 3300042597 | Unclassified | 36639 |
| 167 | Ga0466716_063539 | 3300042605 | Bacteria | 6668 |
| 168 | Ga0466719_106515 | 3300042606 | Bacteria | 3668 |
| 169 | Ga0466722_018130 | 3300042609 | Bacteria | 5521 |
| 170 | Ga0466705_444627 | 3300042612 | Unclassified | 1212 |
| 171 | Ga0466712_040387 | 3300042614 | Bacteria | 2791 |
| 172 | Ga0466718_122562 | 3300042617 | Bacteria | 4458 |
| 173 | Ga0466718_164875 | 3300042617 | Bacteria | 2484 |
| 174 | Ga0466718_168151 | 3300042617 | Bacteria | 4496 |
| 175 | Ga0466723_159596 | 3300042618 | Bacteria | 7359 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01261 | AP_endonuc_2 | Xylose isomerase-like TIM barrel | 66 | 304 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.