Protein Family IF07580
Metagenome
Isolate
185
Members
51
Samples
175
Scaffolds
425.13
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_476427|Ga0466711_476427_393_1763
- Length
- 456 aa
- Sequence
- MQNTLYFARLVRKPEPDRVQSNKFPNKSKEKSMKTGRSKGSVEDAYGLAKEAYAPFGVNTDRVIRAAADIPVSIHCWQGDDITGFENAGGLFGGGILATGNYPGKARNGDELRGDADFAFSLIPGKKRFSLHTLYAETGGNKVSRDTLEPEHFKAWMSWSRKKKIPLDFNPSYFSHPMADSGYTLASADPRIRRFWIRHTIAARKIASAFGSNQGSPSVNNMWAPDGSKDLPADRLSPRLRLRDALDEALAVSLPPKTITDAVEAKLFGIGSEAYVAGSHEFYLGYAAAKQIKLCLDTGHFHPTETIGDKISAVLLFVPGLLVHFSRGLRWDSDHVTTYTDDLRDICREIIRQKALGRVDIALDFFDASINRTAAWIIGTRSVRKALLEALLEPTKLLVDAEKAGKNHVRLALMEEFKTLPFSAVWDKLCLDAGVPVGSDWLDQVNDYEERVLSKR
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.0%
Kalotermitidae
28.0%
Unclassified
22.0%
Rhinotermitidae
8.0%
Termopsidae
6.0%
Taxonomy
Archaea
1
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 2 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 3 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 41 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 45 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 46 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_015361 | 3300042591 | Bacteria | 56574 |
| 2 | Ga0466692_022897 | 3300042591 | Bacteria | 30122 |
| 3 | Ga0466691_090996 | 3300042593 | Bacteria | 3911 |
| 4 | Ga0466699_291435 | 3300042597 | Bacteria | 13412 |
| 5 | Ga0466700_300243 | 3300042600 | Bacteria | 1787 |
| 6 | Ga0466698_490715 | 3300042610 | Bacteria | 2637 |
| 7 | Ga0466709_083487 | 3300042648 | Bacteria | 7115 |
| 8 | Ga0466709_129337 | 3300042648 | Bacteria | 2752 |
| 9 | Ga0466708_109897 | 3300042652 | Bacteria | 4548 |
| 10 | Ga0466708_467196 | 3300042652 | Bacteria | 15542 |
| 11 | Ga0466727_016048 | 3300042655 | Bacteria | 1345 |
| 12 | Ga0466711_208157 | 3300042615 | Bacteria | 16005 |
| 13 | Ga0466728_102247 | 3300042620 | Bacteria | 5906 |
| 14 | AustNasuHG_c1001965 | 3300000089 | Bacteria | 7388 |
| 15 | JGI24702J35022_10019935 | 3300002462 | Bacteria | 3645 |
| 16 | JGI24702J35022_10069563 | 3300002462 | Bacteria | 1893 |
| 17 | Ga0466705_348785 | 3300042612 | Bacteria | 46858 |
| 18 | Ga0456237_0002452 | 3300041968 | Bacteria | 3003 |
| 19 | Ga0466690_104077 | 3300042590 | Bacteria | 2658 |
| 20 | Ga0466690_185777 | 3300042590 | Unclassified | 2666 |
| 21 | Ga0466690_359865 | 3300042590 | Bacteria | 2588 |
| 22 | Ga0466694_155148 | 3300042594 | Bacteria | 33595 |
| 23 | Ga0466696_147008 | 3300042596 | Bacteria | 13930 |
| 24 | Ga0466699_286748 | 3300042597 | Bacteria | 43685 |
| 25 | Ga0466707_194960 | 3300042601 | Bacteria | 6808 |
| 26 | Ga0466717_292072 | 3300042604 | Bacteria | 1887 |
| 27 | Ga0466719_245906 | 3300042606 | Bacteria | 11810 |
| 28 | Ga0466719_255652 | 3300042606 | Bacteria | 23654 |
| 29 | Ga0466719_465932 | 3300042606 | Bacteria | 1842 |
| 30 | Ga0466722_113010 | 3300042609 | Bacteria | 9446 |
| 31 | Ga0466703_236036 | 3300042636 | Bacteria | 14960 |
| 32 | Ga0466703_319445 | 3300042636 | Bacteria | 75536 |
| 33 | Ga0466709_257366 | 3300042648 | Bacteria | 6037 |
| 34 | Ga0466708_242308 | 3300042652 | Bacteria | 14613 |
| 35 | Ga0466711_135785 | 3300042615 | Bacteria | 7395 |
| 36 | Ga0466723_008250 | 3300042618 | Bacteria | 3798 |
| 37 | Ga0466723_033010 | 3300042618 | Bacteria | 16420 |
| 38 | Ga0466726_282271 | 3300042619 | Bacteria | 1492 |
| 39 | JGI24695J34938_10015886 | 3300002450 | Bacteria | 3848 |
| 40 | Ga0466716_003618 | 3300042605 | Bacteria | 4352 |
| 41 | Ga0466716_476600 | 3300042605 | Bacteria | 6196 |
| 42 | Ga0466722_229630 | 3300042609 | Bacteria | 4862 |
| 43 | Ga0466703_071234 | 3300042636 | Bacteria | 32935 |
| 44 | Ga0466704_119938 | 3300042643 | Bacteria | 4307 |
| 45 | Ga0466704_241124 | 3300042643 | Bacteria | 9165 |
| 46 | Ga0466718_007983 | 3300042617 | Bacteria | 11353 |
| 47 | Ga0466723_157692 | 3300042618 | Bacteria | 11721 |
| 48 | Ga0466726_353748 | 3300042619 | Bacteria | 3087 |
| 49 | JGI24702J35022_10054961 | 3300002462 | Bacteria | 2124 |
| 50 | Ga0123356_10346269 | 3300010049 | Bacteria | 1608 |
| 51 | Ga0123353_10251952 | 3300010167 | Bacteria | 2734 |
| 52 | Ga0466705_113128 | 3300042612 | Bacteria | 3891 |
| 53 | Ga0466732_131741 | 3300042656 | Bacteria | 6180 |
| 54 | Ga0466692_004525 | 3300042591 | Bacteria | 19839 |
| 55 | Ga0466692_046713 | 3300042591 | Bacteria | 5283 |
| 56 | Ga0466691_053307 | 3300042593 | Unclassified | 5201 |
| 57 | Ga0466691_191169 | 3300042593 | Bacteria | 3680 |
| 58 | Ga0466699_440089 | 3300042597 | Bacteria | 1782 |
| 59 | Ga0466716_369563 | 3300042605 | Bacteria | 1556 |
| 60 | Ga0466720_113106 | 3300042607 | Bacteria | 5321 |
| 61 | Ga0466722_005743 | 3300042609 | Bacteria | 2251 |
| 62 | Ga0466722_111443 | 3300042609 | Bacteria | 4186 |
| 63 | Ga0466722_130384 | 3300042609 | Bacteria | 3989 |
| 64 | Ga0466704_236505 | 3300042643 | Bacteria | 15020 |
| 65 | Ga0466704_499057 | 3300042643 | Bacteria | 60887 |
| 66 | Ga0466708_108031 | 3300042652 | Bacteria | 2946 |
| 67 | Ga0466705_425805 | 3300042612 | Bacteria | 7231 |
| 68 | Ga0466705_467465 | 3300042612 | Bacteria | 6665 |
| 69 | Ga0466711_123523 | 3300042615 | Bacteria | 13522 |
| 70 | Ga0466711_367078 | 3300042615 | Bacteria | 4888 |
| 71 | Ga0466715_491272 | 3300042616 | Bacteria | 3009 |
| 72 | Ga0466718_152789 | 3300042617 | Archaea | 5518 |
| 73 | Ga0466718_164001 | 3300042617 | Bacteria | 1457 |
| 74 | Ga0123353_10309769 | 3300010167 | Bacteria | 2404 |
| 75 | Ga0466705_226397 | 3300042612 | Bacteria | 3515 |
| 76 | Ga0466732_274053 | 3300042656 | Bacteria | 2701 |
| 77 | Ga0466733_111851 | 3300042659 | Bacteria | 82439 |
| 78 | Ga0466690_014464 | 3300042590 | Bacteria | 11796 |
| 79 | Ga0466690_173356 | 3300042590 | Bacteria | 11418 |
| 80 | Ga0466690_253322 | 3300042590 | Bacteria | 1672 |
| 81 | Ga0466692_160245 | 3300042591 | Bacteria | 21379 |
| 82 | Ga0466693_379272 | 3300042592 | Bacteria | 19669 |
| 83 | Ga0466694_172701 | 3300042594 | Bacteria | 7166 |
| 84 | Ga0466696_048414 | 3300042596 | Bacteria | 4251 |
| 85 | Ga0466722_102068 | 3300042609 | Bacteria | 4215 |
| 86 | Ga0466704_415680 | 3300042643 | Unclassified | 3426 |
| 87 | Ga0466708_283337 | 3300042652 | Bacteria | 3018 |
| 88 | Ga0466715_210750 | 3300042616 | Bacteria | 13270 |
| 89 | Ga0466718_169125 | 3300042617 | Bacteria | 3905 |
| 90 | Ga0466723_009818 | 3300042618 | Bacteria | 36345 |
| 91 | Ga0466726_016063 | 3300042619 | Bacteria | 3570 |
| 92 | JGI24695J34938_10000608 | 3300002450 | Bacteria | 34329 |
| 93 | JGI24695J34938_10020772 | 3300002450 | Bacteria | 3225 |
| 94 | JGI24702J35022_10059643 | 3300002462 | Bacteria | 2039 |
| 95 | Ga0123355_10003085 | 3300009826 | Bacteria | 23756 |
| 96 | Ga0123356_10057472 | 3300010049 | Bacteria | 3626 |
| 97 | Ga0123353_10117725 | 3300010167 | Bacteria | 4273 |
| 98 | Ga0466705_125523 | 3300042612 | Bacteria | 7188 |
| 99 | Ga0466705_216735 | 3300042612 | Bacteria | 10484 |
| 100 | Ga0466691_052841 | 3300042593 | Bacteria | 2889 |
| 101 | Ga0466691_130833 | 3300042593 | Bacteria | 9201 |
| 102 | Ga0466695_185731 | 3300042595 | Bacteria | 1791 |
| 103 | Ga0466695_246466 | 3300042595 | Bacteria | 7313 |
| 104 | Ga0466700_427777 | 3300042600 | Bacteria | 1450 |
| 105 | Ga0466722_024701 | 3300042609 | Bacteria | 2750 |
| 106 | Ga0466722_218227 | 3300042609 | Bacteria | 1552 |
| 107 | Ga0466722_224262 | 3300042609 | Bacteria | 3958 |
| 108 | Ga0466698_338487 | 3300042610 | Bacteria | 1836 |
| 109 | Ga0466698_501657 | 3300042610 | Bacteria | 1594 |
| 110 | Ga0466735_183111 | 3300042624 | Bacteria | 17201 |
| 111 | Ga0466709_024007 | 3300042648 | Bacteria | 17888 |
| 112 | Ga0466711_032012 | 3300042615 | Bacteria | 13247 |
| 113 | Ga0466715_257388 | 3300042616 | Bacteria | 8518 |
| 114 | Ga0466718_066966 | 3300042617 | Bacteria | 32992 |
| 115 | Ga0466726_287535 | 3300042619 | Bacteria | 15444 |
| 116 | Ga0466728_418469 | 3300042620 | Bacteria | 7462 |
| 117 | JGI24695J34938_10000483 | 3300002450 | Bacteria | 38716 |
| 118 | JGI24695J34938_10000703 | 3300002450 | Bacteria | 31469 |
| 119 | JGI24695J34938_10003659 | 3300002450 | Bacteria | 10538 |
| 120 | Ga0466705_232947 | 3300042612 | Bacteria | 5695 |
| 121 | Ga0466733_032730 | 3300042659 | Bacteria | 3524 |
| 122 | Ga0466733_084293 | 3300042659 | Bacteria | 10083 |
| 123 | Ga0466691_142836 | 3300042593 | Bacteria | 24101 |
| 124 | Ga0466691_180310 | 3300042593 | Bacteria | 3244 |
| 125 | Ga0466694_042311 | 3300042594 | Bacteria | 2871 |
| 126 | Ga0466699_034751 | 3300042597 | Bacteria | 3218 |
| 127 | Ga0466716_115216 | 3300042605 | Bacteria | 4977 |
| 128 | Ga0466716_145005 | 3300042605 | Bacteria | 2807 |
| 129 | Ga0466716_151113 | 3300042605 | Bacteria | 3449 |
| 130 | Ga0466719_144176 | 3300042606 | Bacteria | 32253 |
| 131 | Ga0466719_327763 | 3300042606 | Bacteria | 4346 |
| 132 | Ga0466720_059318 | 3300042607 | Bacteria | 7847 |
| 133 | Ga0466720_076304 | 3300042607 | Bacteria | 5626 |
| 134 | Ga0466722_046317 | 3300042609 | Bacteria | 10772 |
| 135 | Ga0466722_164323 | 3300042609 | Bacteria | 3784 |
| 136 | Ga0466729_240064 | 3300042621 | Bacteria | 2114 |
| 137 | Ga0466703_107891 | 3300042636 | Bacteria | 6970 |
| 138 | Ga0466703_242820 | 3300042636 | Bacteria | 15331 |
| 139 | Ga0466703_318719 | 3300042636 | Bacteria | 5907 |
| 140 | Ga0466704_186070 | 3300042643 | Bacteria | 9812 |
| 141 | Ga0466704_388103 | 3300042643 | Bacteria | 7107 |
| 142 | Ga0466704_502134 | 3300042643 | Bacteria | 9591 |
| 143 | Ga0466708_243686 | 3300042652 | Bacteria | 7322 |
| 144 | Ga0466708_313738 | 3300042652 | Bacteria | 34279 |
| 145 | Ga0466708_412850 | 3300042652 | Bacteria | 3203 |
| 146 | Ga0466727_168863 | 3300042655 | Bacteria | 13700 |
| 147 | Ga0466727_337440 | 3300042655 | Bacteria | 3892 |
| 148 | Ga0466712_169664 | 3300042614 | Bacteria | 3713 |
| 149 | Ga0466711_047064 | 3300042615 | Bacteria | 2938 |
| 150 | Ga0466711_300996 | 3300042615 | Bacteria | 14907 |
| 151 | Ga0466711_476427 | 3300042615 | Bacteria | 3345 |
| 152 | Ga0466715_008470 | 3300042616 | Bacteria | 12262 |
| 153 | Ga0466715_276095 | 3300042616 | Bacteria | 16435 |
| 154 | Ga0466715_337385 | 3300042616 | Bacteria | 28368 |
| 155 | Ga0466723_245114 | 3300042618 | Bacteria | 7337 |
| 156 | Ga0466705_091256 | 3300042612 | Bacteria | 4391 |
| 157 | Ga0264413_102388 | 3300024493 | Bacteria | 4302 |
| 158 | Ga0466692_029660 | 3300042591 | Bacteria | 1826 |
| 159 | Ga0466692_048877 | 3300042591 | Bacteria | 18134 |
| 160 | Ga0466691_202792 | 3300042593 | Bacteria | 8282 |
| 161 | Ga0466699_431772 | 3300042597 | Unclassified | 2121 |
| 162 | Ga0466700_419790 | 3300042600 | Bacteria | 3869 |
| 163 | Ga0466722_016917 | 3300042609 | Bacteria | 5683 |
| 164 | Ga0466722_107511 | 3300042609 | Bacteria | 4337 |
| 165 | Ga0466698_455918 | 3300042610 | Bacteria | 1619 |
| 166 | Ga0466735_154581 | 3300042624 | Bacteria | 1641 |
| 167 | Ga0466704_120081 | 3300042643 | Bacteria | 2535 |
| 168 | Ga0466704_259415 | 3300042643 | Bacteria | 7889 |
| 169 | Ga0466711_176014 | 3300042615 | Bacteria | 31697 |
| 170 | Ga0466718_055055 | 3300042617 | Bacteria | 3830 |
| 171 | Ga0466723_045136 | 3300042618 | Bacteria | 5835 |
| 172 | Ga0466723_057705 | 3300042618 | Bacteria | 15524 |
| 173 | Ga0466723_062026 | 3300042618 | Bacteria | 15316 |
| 174 | Ga0466728_097620 | 3300042620 | Bacteria | 5812 |
| 175 | Ga0123356_10139740 | 3300010049 | Bacteria | 2388 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06134 | RhaA | L-rhamnose isomerase (RhaA) | 42 | 456 | 1 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.