Protein Family IF07530
Metagenome
Isolate
165
Members
48
Samples
162
Scaffolds
114.59
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_229235|Ga0466711_229235_591_995
- Length
- 134 aa
- Sequence
- MRLLWGGVNKTGALWYKGNIMDDCIFCKIIAGEIPGRKIYEDDEMLAFHDINPQSPVHFLLIPKRHIPNIMELGPGDIALAGRLLYKAQELAGLLGCAEKGARFVINHKSDGGQTVDHLHIHVLGGRPLAWPPG
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.8%
Kalotermitidae
29.2%
Rhinotermitidae
8.3%
Termopsidae
6.2%
Unclassified
4.2%
Culicidae
4.2%
Blaberidae
2.1%
Alydidae
2.1%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 30 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 35 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_133772 | 3300042656 | Bacteria | 3810 |
| 2 | Ga0466690_225277 | 3300042590 | Unclassified | 5474 |
| 3 | Ga0466692_077793 | 3300042591 | Bacteria | 13288 |
| 4 | Ga0466691_199989 | 3300042593 | Bacteria | 1082 |
| 5 | JGI24695J34938_10126134 | 3300002450 | Bacteria | 1043 |
| 6 | JGI24702J35022_10008378 | 3300002462 | Bacteria | 5854 |
| 7 | Ga0466719_016908 | 3300042606 | Bacteria | 25606 |
| 8 | Ga0466720_025302 | 3300042607 | Bacteria | 9128 |
| 9 | Ga0466720_063778 | 3300042607 | Bacteria | 2132 |
| 10 | Ga0123356_10303723 | 3300010049 | Bacteria | 1702 |
| 11 | Ga0466711_184950 | 3300042615 | Bacteria | 5823 |
| 12 | Ga0466718_010831 | 3300042617 | Bacteria | 16954 |
| 13 | Ga0466723_011867 | 3300042618 | Bacteria | 5048 |
| 14 | Ga0466723_223711 | 3300042618 | Bacteria | 3349 |
| 15 | Ga0466723_271934 | 3300042618 | Bacteria | 6848 |
| 16 | Ga0160459_100087 | 3300012831 | Unclassified | 102976 |
| 17 | Ga0466691_051130 | 3300042593 | Bacteria | 2016 |
| 18 | JGI24698J34947_10004547 | 3300002449 | Bacteria | 7557 |
| 19 | JGI24695J34938_10476724 | 3300002450 | Bacteria | 567 |
| 20 | Ga0466716_086078 | 3300042605 | Bacteria | 3485 |
| 21 | Ga0466720_065988 | 3300042607 | Unclassified | 10464 |
| 22 | Ga0466720_075768 | 3300042607 | Bacteria | 11472 |
| 23 | Ga0466720_223011 | 3300042607 | Bacteria | 10637 |
| 24 | Ga0466722_142767 | 3300042609 | Bacteria | 1939 |
| 25 | Ga0466727_301489 | 3300042655 | Bacteria | 4275 |
| 26 | Ga0466705_081578 | 3300042612 | Bacteria | 4570 |
| 27 | Ga0466711_370467 | 3300042615 | Bacteria | 26278 |
| 28 | Ga0466723_134094 | 3300042618 | Bacteria | 5226 |
| 29 | Ga0466723_209645 | 3300042618 | Unclassified | 2840 |
| 30 | Ga0466726_134888 | 3300042619 | Bacteria | 16994 |
| 31 | Ga0466732_010791 | 3300042656 | Bacteria | 9084 |
| 32 | Ga0466691_010871 | 3300042593 | Bacteria | 49888 |
| 33 | Ga0466696_304119 | 3300042596 | Bacteria | 2421 |
| 34 | Ga0466707_411102 | 3300042601 | Bacteria | 1092 |
| 35 | Ga0466722_091914 | 3300042609 | Bacteria | 5920 |
| 36 | Ga0466704_559417 | 3300042643 | Bacteria | 7617 |
| 37 | Ga0466727_183282 | 3300042655 | Bacteria | 9933 |
| 38 | Ga0466715_327706 | 3300042616 | Bacteria | 2302 |
| 39 | Ga0466723_371918 | 3300042618 | Bacteria | 1873 |
| 40 | Ga0466726_060014 | 3300042619 | Bacteria | 12594 |
| 41 | Ga0466690_290489 | 3300042590 | Bacteria | 16449 |
| 42 | Ga0466696_214698 | 3300042596 | Bacteria | 1572 |
| 43 | Ga0466699_393490 | 3300042597 | Bacteria | 1767 |
| 44 | Ga0466699_441566 | 3300042597 | Bacteria | 11968 |
| 45 | JGI24695J34938_10001739 | 3300002450 | Bacteria | 18011 |
| 46 | Ga0466707_244499 | 3300042601 | Bacteria | 2609 |
| 47 | Ga0466717_074479 | 3300042604 | Bacteria | 1877 |
| 48 | Ga0466719_012937 | 3300042606 | Bacteria | 1714 |
| 49 | Ga0466703_035126 | 3300042636 | Unclassified | 7838 |
| 50 | Ga0466709_019236 | 3300042648 | Bacteria | 18315 |
| 51 | Ga0466709_069183 | 3300042648 | Bacteria | 9816 |
| 52 | Ga0466705_058541 | 3300042612 | Bacteria | 23211 |
| 53 | Ga0466712_089271 | 3300042614 | Bacteria | 10329 |
| 54 | Ga0466718_035952 | 3300042617 | Bacteria | 12566 |
| 55 | Ga0160470_102127 | 3300012813 | Bacteria | 3993 |
| 56 | Ga0415639_011189 | 3300038395 | Bacteria | 3318 |
| 57 | Ga0466696_035144 | 3300042596 | Bacteria | 3845 |
| 58 | Ga0466696_210466 | 3300042596 | Bacteria | 1681 |
| 59 | Ga0466696_351178 | 3300042596 | Bacteria | 3462 |
| 60 | AustNasuHG_c1010487 | 3300000089 | Bacteria | 3227 |
| 61 | JGI24698J34947_10123358 | 3300002449 | Bacteria | 1120 |
| 62 | Ga0466716_381964 | 3300042605 | Unclassified | 1580 |
| 63 | Ga0466719_216479 | 3300042606 | Bacteria | 2457 |
| 64 | Ga0466720_137187 | 3300042607 | Bacteria | 15044 |
| 65 | Ga0466722_158620 | 3300042609 | Bacteria | 9322 |
| 66 | Ga0466722_159680 | 3300042609 | Unclassified | 1335 |
| 67 | Ga0123354_10330960 | 3300010882 | Bacteria | 1389 |
| 68 | Ga0466704_247319 | 3300042643 | Bacteria | 1991 |
| 69 | Ga0466727_137357 | 3300042655 | Bacteria | 1851 |
| 70 | Ga0466705_195947 | 3300042612 | Bacteria | 5179 |
| 71 | Ga0466712_073120 | 3300042614 | Bacteria | 11288 |
| 72 | Ga0466712_267126 | 3300042614 | Bacteria | 1646 |
| 73 | Ga0466711_166179 | 3300042615 | Bacteria | 4283 |
| 74 | Ga0466711_181274 | 3300042615 | Bacteria | 1530 |
| 75 | Ga0466711_229235 | 3300042615 | Bacteria | 1034 |
| 76 | Ga0466723_299213 | 3300042618 | Bacteria | 2679 |
| 77 | Ga0466726_462529 | 3300042619 | Bacteria | 1890 |
| 78 | Ga0466729_102216 | 3300042621 | Bacteria | 1784 |
| 79 | Ga0456237_0002968 | 3300041968 | Bacteria | 2756 |
| 80 | Ga0466690_089720 | 3300042590 | Bacteria | 2143 |
| 81 | Ga0466692_018240 | 3300042591 | Bacteria | 1005 |
| 82 | Ga0466692_148938 | 3300042591 | Bacteria | 8077 |
| 83 | Ga0466699_008552 | 3300042597 | Unclassified | 2707 |
| 84 | JGI24698J34947_10218795 | 3300002449 | Bacteria | 732 |
| 85 | JGI24695J34938_10055086 | 3300002450 | Bacteria | 1721 |
| 86 | JGI24705J35276_11404010 | 3300002504 | Bacteria | 528 |
| 87 | JGI24699J35502_10488093 | 3300002509 | Bacteria | 609 |
| 88 | Ga0072940_1026603 | 3300005200 | Bacteria | 1455 |
| 89 | Ga0466707_423295 | 3300042601 | Unclassified | 1460 |
| 90 | Ga0466716_049451 | 3300042605 | Bacteria | 1177 |
| 91 | Ga0466720_066322 | 3300042607 | Bacteria | 8494 |
| 92 | Ga0466722_005318 | 3300042609 | Bacteria | 2038 |
| 93 | Ga0466722_148488 | 3300042609 | Bacteria | 1665 |
| 94 | Ga0466722_157426 | 3300042609 | Bacteria | 2224 |
| 95 | Ga0466722_242343 | 3300042609 | Bacteria | 7097 |
| 96 | Ga0466698_416215 | 3300042610 | Bacteria | 1713 |
| 97 | Ga0123356_10462299 | 3300010049 | Bacteria | 1419 |
| 98 | Ga0466735_101671 | 3300042624 | Bacteria | 2406 |
| 99 | Ga0466708_293306 | 3300042652 | Unclassified | 2479 |
| 100 | Ga0466727_192609 | 3300042655 | Bacteria | 10130 |
| 101 | Ga0466705_075588 | 3300042612 | Bacteria | 9194 |
| 102 | Ga0466705_258660 | 3300042612 | Bacteria | 3079 |
| 103 | Ga0466705_499092 | 3300042612 | Bacteria | 2935 |
| 104 | Ga0466726_031363 | 3300042619 | Bacteria | 20660 |
| 105 | Ga0466728_198803 | 3300042620 | Bacteria | 6460 |
| 106 | Ga0466732_261181 | 3300042656 | Bacteria | 7125 |
| 107 | Ga0466732_302267 | 3300042656 | Bacteria | 17743 |
| 108 | Ga0415639_000496 | 3300038395 | Bacteria | 2450 |
| 109 | Ga0466691_019433 | 3300042593 | Bacteria | 4955 |
| 110 | Ga0466699_036517 | 3300042597 | Bacteria | 13115 |
| 111 | JGI24695J34938_10024501 | 3300002450 | Bacteria | 2898 |
| 112 | JGI24702J35022_10000436 | 3300002462 | Bacteria | 25172 |
| 113 | Ga0466707_020783 | 3300042601 | Bacteria | 1011 |
| 114 | Ga0466719_033453 | 3300042606 | Bacteria | 2219 |
| 115 | Ga0123357_10167713 | 3300009784 | Bacteria | 2609 |
| 116 | Ga0123356_11247005 | 3300010049 | Bacteria | 908 |
| 117 | Ga0123356_11253991 | 3300010049 | Unclassified | 906 |
| 118 | Ga0123356_12478249 | 3300010049 | Bacteria | 649 |
| 119 | Ga0123353_10966949 | 3300010167 | Bacteria | 1149 |
| 120 | Ga0123353_11084354 | 3300010167 | Bacteria | 1065 |
| 121 | Ga0466705_096146 | 3300042612 | Bacteria | 2081 |
| 122 | Ga0466712_232259 | 3300042614 | Bacteria | 1170 |
| 123 | Ga0466711_128285 | 3300042615 | Bacteria | 23830 |
| 124 | Ga0466718_156646 | 3300042617 | Bacteria | 4956 |
| 125 | Ga0466728_174451 | 3300042620 | Bacteria | 1479 |
| 126 | Ga0466728_370423 | 3300042620 | Bacteria | 1004 |
| 127 | Ga0456237_0000162 | 3300041968 | Bacteria | 9687 |
| 128 | Ga0466696_029803 | 3300042596 | Bacteria | 25127 |
| 129 | Nasutiter_Contig08649 | 2030936001 | Unclassified | 771 |
| 130 | AustNasuHG_c1000386 | 3300000089 | Bacteria | 15293 |
| 131 | AustNasuHG_c1023973 | 3300000089 | Bacteria | 1941 |
| 132 | AustNasuHG_c1082068 | 3300000089 | Bacteria | 542 |
| 133 | JGI24698J34947_10001256 | 3300002449 | Bacteria | 13265 |
| 134 | JGI24698J34947_10036207 | 3300002449 | Bacteria | 2571 |
| 135 | JGI24698J34947_10037204 | 3300002449 | Bacteria | 2530 |
| 136 | JGI24698J34947_10063426 | 3300002449 | Unclassified | 1811 |
| 137 | JGI24698J34947_10077358 | 3300002449 | Unclassified | 1573 |
| 138 | JGI24695J34938_10010183 | 3300002450 | Bacteria | 5175 |
| 139 | Ga0074263_116734 | 3300005485 | Bacteria | 3245 |
| 140 | Ga0466707_050376 | 3300042601 | Bacteria | 3167 |
| 141 | Ga0466707_234091 | 3300042601 | Bacteria | 1215 |
| 142 | Ga0466707_263773 | 3300042601 | Bacteria | 1045 |
| 143 | Ga0466716_132104 | 3300042605 | Bacteria | 3767 |
| 144 | Ga0466719_073441 | 3300042606 | Bacteria | 6541 |
| 145 | Ga0466722_076800 | 3300042609 | Unclassified | 2633 |
| 146 | Ga0123357_10043634 | 3300009784 | Bacteria | 6092 |
| 147 | Ga0123356_10095923 | 3300010049 | Bacteria | 2835 |
| 148 | Ga0123356_11093522 | 3300010049 | Bacteria | 966 |
| 149 | Ga0466729_292794 | 3300042621 | Bacteria | 2360 |
| 150 | Ga0466704_506118 | 3300042643 | Bacteria | 2825 |
| 151 | Ga0466709_029540 | 3300042648 | Bacteria | 12536 |
| 152 | Ga0466709_415969 | 3300042648 | Bacteria | 1021 |
| 153 | Ga0466708_058741 | 3300042652 | Unclassified | 2155 |
| 154 | Ga0466727_260572 | 3300042655 | Unclassified | 3050 |
| 155 | Ga0466705_225699 | 3300042612 | Unclassified | 10304 |
| 156 | Ga0466705_284233 | 3300042612 | Bacteria | 4116 |
| 157 | Ga0466712_046764 | 3300042614 | Bacteria | 3647 |
| 158 | Ga0466715_004875 | 3300042616 | Bacteria | 8067 |
| 159 | Ga0466715_045416 | 3300042616 | Bacteria | 3160 |
| 160 | Ga0466715_492592 | 3300042616 | Bacteria | 12189 |
| 161 | Ga0466718_131456 | 3300042617 | Bacteria | 1636 |
| 162 | Ga0466728_181936 | 3300042620 | Bacteria | 2158 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01230 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.