Protein Family IF07506

Metagenome Isolate
108 Members
48 Samples
99 Scaffolds
349.48 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_152498|Ga0466711_152498_3057_4169
Length
370 aa
Sequence
MILSAACGACEQTISRGRKIMKSLIVDENHVLSIRELPVPSYKECQALVKTLSCGVCNGTDLKLIHGAFKNFDTYPAALGHEGVGKVVEVGSKVRNLHIGDIVLLPFLEGKSGEVYSGWGAYSEYAVVGDAEAYIAHGMGPGTPEFSEGYLAQTVIKPEDKVDPVEASMIITFREVLSAIRRFGFKPNENVLIFGAGPVGLCFTKFSKLLGLKTVITADIDDAKVRFAGQAGADYAFNSQACDIGAEVKGLFPDGIDYVVDAVGINQLINQGMELVKYNGKICCYGISPKLGMDLDWSKAPYNWSLDFVQWPSKKEESEAHAQIMAWINLGVLDPKDFISDVFDFEHILDAFKLVEARKSSTKKIVVRYY

📊 Sample Types

Isolate 8.3%
Metagenome 91.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.2%
Kalotermitidae 29.2%
Unclassified 22.9%
Rhinotermitidae 6.2%
Termopsidae 6.2%
Passalidae 2.1%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 85
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
2 2820450073 Unclassified Firmicutes Lab288P3bin186 Isolate Unclassified
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
5 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
6 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
7 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
8 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
9 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
10 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
38 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
39 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
42 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
46 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
47 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_037648 3300042612 Bacteria 22325
2 Ga0466692_126201 3300042591 Unclassified 1162
3 Ga0466699_072488 3300042597 Bacteria 13556
4 Ga0466707_202514 3300042601 Unclassified 2198
5 Ga0466722_068502 3300042609 Bacteria 3318
6 Ga0466704_297275 3300042643 Bacteria 20574
7 Ga0466718_122724 3300042617 Bacteria 29201
8 Ga0466728_049549 3300042620 Bacteria 4100
9 Ga0466705_112672 3300042612 Bacteria 13222
10 Ga0466696_382391 3300042596 Bacteria 2461
11 Ga0466713_066031 3300042602 Bacteria 72966
12 Ga0466719_317213 3300042606 Bacteria 9863
13 Ga0466722_022491 3300042609 Bacteria 7757
14 Ga0466698_245856 3300042610 Unclassified 2055
15 Ga0466708_327626 3300042652 Bacteria 7825
16 Ga0466727_094986 3300042655 Bacteria 2839
17 JGI24698J34947_10006656 3300002449 Bacteria 6345
18 JGI24698J34947_10012089 3300002449 Bacteria 4737
19 Ga0466711_063532 3300042615 Bacteria 1536
20 Ga0466711_152498 3300042615 Bacteria 8562
21 Ga0466715_021772 3300042616 Bacteria 2079
22 Ga0466715_124958 3300042616 Unclassified 4048
23 Ga0466715_243107 3300042616 Bacteria 23287
24 Ga0466718_104246 3300042617 Bacteria 1411
25 Ga0466726_376924 3300042619 Bacteria 1525
26 Ga0123353_10070620 3300010167 Bacteria 5610
27 Ga0466696_065598 3300042596 Bacteria 3659
28 Ga0466706_191688 3300042599 Bacteria 1373
29 Ga0466714_130966 3300042603 Unclassified 1651
30 Ga0466727_002302 3300042655 Unclassified 1560
31 Ga0466727_267064 3300042655 Bacteria 10706
32 Ga0466712_033007 3300042614 Bacteria 6895
33 Ga0466718_089500 3300042617 Bacteria 12240
34 Ga0466718_134860 3300042617 Unclassified 2363
35 Ga0123356_10001262 3300010049 Bacteria 27972
36 Ga0123353_10016241 3300010167 Bacteria 10870
37 Ga0123353_10470935 3300010167 Bacteria 1842
38 Ga0466705_012102 3300042612 Bacteria 11344
39 Ga0466699_072654 3300042597 Bacteria 17368
40 Ga0466698_009676 3300042610 Unclassified 2689
41 IMNBL1DRAFT_c0000090 3300000062 Bacteria 79466
42 JGI24702J35022_10008638 3300002462 Bacteria 5756
43 Ga0068302_10004568 3300005071 Bacteria 18680
44 Ga0466705_516246 3300042612 Unclassified 1173
45 Ga0466712_133266 3300042614 Bacteria 38197
46 Ga0466711_036068 3300042615 Bacteria 11740
47 Ga0466728_376755 3300042620 Bacteria 5740
48 Ga0123357_10024492 3300009784 Unclassified 8126
49 Ga0466691_137442 3300042593 Bacteria 18156
50 Ga0466696_174270 3300042596 Bacteria 1815
51 Ga0466700_325646 3300042600 Unclassified 2008
52 Ga0466714_017064 3300042603 Bacteria 4008
53 Ga0466704_209227 3300042643 Bacteria 22130
54 Ga0466709_192465 3300042648 Bacteria 12086
55 Ga0072940_1013335 3300005200 Bacteria 6934
56 Ga0466711_374674 3300042615 Bacteria 2766
57 Ga0466715_196960 3300042616 Bacteria 26823
58 Ga0466723_157884 3300042618 Bacteria 6355
59 Ga0466726_273761 3300042619 Unclassified 1512
60 Ga0466729_019746 3300042621 Bacteria 44807
61 Ga0123353_10003289 3300010167 Bacteria 20399
62 Ga0123354_10386285 3300010882 Unclassified 1202
63 Ga0466705_158065 3300042612 Bacteria 5481
64 Ga0466692_175200 3300042591 Unclassified 1834
65 Ga0466691_177490 3300042593 Bacteria 7343
66 Ga0466696_194089 3300042596 Unclassified 2259
67 Ga0466706_052045 3300042599 Bacteria 18680
68 Ga0466713_049612 3300042602 Bacteria 8800
69 Ga0466719_222392 3300042606 Bacteria 38323
70 Ga0466698_008068 3300042610 Unclassified 3108
71 Ga0466704_180702 3300042643 Bacteria 47161
72 Ga0068305_10113972 3300005083 Bacteria 3016
73 Ga0466711_268738 3300042615 Bacteria 4150
74 Ga0466715_014039 3300042616 Bacteria 16911
75 Ga0466723_053458 3300042618 Bacteria 10880
76 Ga0123357_10283829 3300009784 Bacteria 1705
77 Ga0123353_10227947 3300010167 Bacteria 2907
78 Ga0466690_085825 3300042590 Unclassified 1262
79 Ga0466716_169074 3300042605 Bacteria 11676
80 Ga0466722_122282 3300042609 Bacteria 12959
81 Ga0466703_249685 3300042636 Unclassified 4642
82 Ga0466704_166598 3300042643 Bacteria 2852
83 Ga0466709_372349 3300042648 Bacteria 6413
84 Ga0466708_064379 3300042652 Bacteria 13151
85 Ga0466723_141548 3300042618 Bacteria 2679
86 Ga0123354_10168961 3300010882 Unclassified 2555
87 Ga0466694_052549 3300042594 Bacteria 18730
88 Ga0466699_210660 3300042597 Unclassified 1867
89 Ga0466699_231906 3300042597 Bacteria 29115
90 Ga0466714_011398 3300042603 Unclassified 2414
91 Ga0466716_260478 3300042605 Bacteria 5113
92 Ga0466703_124142 3300042636 Bacteria 37704
93 Ga0466709_115674 3300042648 Bacteria 9721
94 Ga0466727_064566 3300042655 Bacteria 9814
95 Ga0466718_033074 3300042617 Unclassified 1974
96 Ga0466718_095110 3300042617 Bacteria 20190
97 Ga0466718_167421 3300042617 Unclassified 1538
98 Ga0123357_10290387 3300009784 Bacteria 1671
99 Ga0123353_10457936 3300010167 Bacteria 1875

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_273761 Ga0466726_273761_364_1275 303
2 3300042620 Ga0466728_049549 Ga0466728_049549_1758_2687 309
3 3300042612 Ga0466705_516246 Ga0466705_516246_63_998 311
4 3300042606 Ga0466719_222392 Ga0466719_222392_18124_19083 319
5 3300042597 Ga0466699_072654 Ga0466699_072654_16082_17077 331
6 3300042655 Ga0466727_094986 Ga0466727_094986_1638_2705 341
7 iso_pr_bacteria 2820639607 2820641086 344
8 3300042616 Ga0466715_014039 Ga0466715_014039_7974_9011 345
9 iso_pr_bacteria 2529293168 2531453218 346
10 3300009784 Ga0123357_10290387 Ga0123357_102903872 347
11 3300042599 Ga0466706_052045 Ga0466706_052045_17188_18231 347
12 3300042599 Ga0466706_191688 Ga0466706_191688_37_1080 347
13 3300009784 Ga0123357_10283829 Ga0123357_102838292 348
14 3300042596 Ga0466696_174270 Ga0466696_174270_672_1721 349
15 3300042609 Ga0466722_022491 Ga0466722_022491_5191_6240 349
16 3300042609 Ga0466722_068502 Ga0466722_068502_2060_3109 349
17 3300042609 Ga0466722_122282 Ga0466722_122282_4135_5184 349
18 3300042610 Ga0466698_008068 Ga0466698_008068_222_1271 349
19 3300042610 Ga0466698_245856 Ga0466698_245856_984_2033 349
20 3300042612 Ga0466705_037648 Ga0466705_037648_9228_10277 349
21 3300042612 Ga0466705_112672 Ga0466705_112672_9337_10386 349
22 3300042612 Ga0466705_158065 Ga0466705_158065_1164_2213 349
23 3300042615 Ga0466711_063532 Ga0466711_063532_119_1168 349
24 3300042615 Ga0466711_374674 Ga0466711_374674_341_1390 349
25 3300042617 Ga0466718_095110 Ga0466718_095110_1330_2379 349
26 3300042617 Ga0466718_122724 Ga0466718_122724_1067_2116 349
27 3300042636 Ga0466703_124142 Ga0466703_124142_17446_18495 349
28 3300042636 Ga0466703_249685 Ga0466703_249685_2969_4018 349
29 3300042643 Ga0466704_166598 Ga0466704_166598_1469_2518 349
30 3300042643 Ga0466704_180702 Ga0466704_180702_22799_23848 349
31 3300042648 Ga0466709_192465 Ga0466709_192465_3721_4770 349
32 3300042652 Ga0466708_064379 Ga0466708_064379_7670_8719 349
33 3300042652 Ga0466708_327626 Ga0466708_327626_634_1683 349
34 3300042655 Ga0466727_002302 Ga0466727_002302_500_1549 349
35 3300042655 Ga0466727_267064 Ga0466727_267064_5015_6064 349
36 iso_pr_bacteria 2820450073 2820450783 349
37 iso_pr_bacteria 2820573558 2820574499 349
38 3300000062 IMNBL1DRAFT_c0000090 IMNBL1DRAFT_000009055 350
39 3300005083 Ga0068305_10113972 Ga0068305_101139722 350
40 3300010049 Ga0123356_10001262 Ga0123356_1000126211 350
41 3300010167 Ga0123353_10003289 Ga0123353_1000328918 350
42 3300010167 Ga0123353_10016241 Ga0123353_1001624110 350
43 3300010167 Ga0123353_10070620 Ga0123353_100706202 350
44 3300010167 Ga0123353_10227947 Ga0123353_102279472 350
45 3300010167 Ga0123353_10457936 Ga0123353_104579362 350
46 3300042590 Ga0466690_085825 Ga0466690_085825_57_1109 350
47 3300042591 Ga0466692_126201 Ga0466692_126201_49_1101 350
48 3300042591 Ga0466692_175200 Ga0466692_175200_750_1802 350
49 3300042593 Ga0466691_137442 Ga0466691_137442_9155_10207 350
50 3300042593 Ga0466691_177490 Ga0466691_177490_2593_3645 350
51 3300042596 Ga0466696_065598 Ga0466696_065598_744_1796 350
52 3300042596 Ga0466696_194089 Ga0466696_194089_195_1247 350
53 3300042596 Ga0466696_382391 Ga0466696_382391_440_1492 350
54 3300042597 Ga0466699_072488 Ga0466699_072488_338_1390 350
55 3300042597 Ga0466699_210660 Ga0466699_210660_451_1503 350
56 3300042597 Ga0466699_231906 Ga0466699_231906_5817_6869 350
57 3300042600 Ga0466700_325646 Ga0466700_325646_128_1180 350
58 3300042605 Ga0466716_260478 Ga0466716_260478_4002_5054 350
59 3300042606 Ga0466719_317213 Ga0466719_317213_6289_7341 350
60 3300042610 Ga0466698_009676 Ga0466698_009676_573_1625 350
61 3300042612 Ga0466705_012102 Ga0466705_012102_7217_8269 350
62 3300042614 Ga0466712_033007 Ga0466712_033007_1676_2728 350
63 3300042614 Ga0466712_133266 Ga0466712_133266_17076_18128 350
64 3300042615 Ga0466711_036068 Ga0466711_036068_4152_5204 350
65 3300042616 Ga0466715_196960 Ga0466715_196960_16047_17099 350
66 3300042617 Ga0466718_033074 Ga0466718_033074_66_1118 350
67 3300042617 Ga0466718_104246 Ga0466718_104246_60_1112 350
68 3300042617 Ga0466718_134860 Ga0466718_134860_1172_2224 350
69 3300042617 Ga0466718_167421 Ga0466718_167421_182_1234 350
70 3300042618 Ga0466723_053458 Ga0466723_053458_1944_2996 350
71 3300042618 Ga0466723_141548 Ga0466723_141548_1365_2417 350
72 3300042618 Ga0466723_157884 Ga0466723_157884_2624_3676 350
73 3300042621 Ga0466729_019746 Ga0466729_019746_11933_12985 350
74 3300042643 Ga0466704_209227 Ga0466704_209227_20400_21452 350
75 3300042648 Ga0466709_372349 Ga0466709_372349_2239_3291 350
76 iso_pr_bacteria 2781125632 2781269826 350
77 iso_pr_bacteria 2781125652 2781312497 350
78 iso_pr_bacteria 2781125686 2781419639 350
79 3300002449 JGI24698J34947_10006656 JGI24698J34947_100066563 351
80 3300002449 JGI24698J34947_10012089 JGI24698J34947_100120893 351
81 3300005200 Ga0072940_1013335 Ga0072940_10133352 351
82 3300009784 Ga0123357_10024492 Ga0123357_100244929 351
83 3300010882 Ga0123354_10168961 Ga0123354_101689612 351
84 3300010882 Ga0123354_10386285 Ga0123354_103862851 351
85 3300042601 Ga0466707_202514 Ga0466707_202514_173_1228 351
86 3300042602 Ga0466713_066031 Ga0466713_066031_22839_23894 351
87 3300042616 Ga0466715_124958 Ga0466715_124958_424_1479 351
88 3300042643 Ga0466704_297275 Ga0466704_297275_3068_4123 351
89 3300042603 Ga0466714_011398 Ga0466714_011398_449_1507 352
90 3300042603 Ga0466714_017064 Ga0466714_017064_544_1602 352
91 3300042603 Ga0466714_130966 Ga0466714_130966_437_1495 352
92 3300042619 Ga0466726_376924 Ga0466726_376924_88_1149 353
93 iso_pr_bacteria 2781125690 2781428143 354
94 3300042616 Ga0466715_243107 Ga0466715_243107_13328_14395 355
95 3300042648 Ga0466709_115674 Ga0466709_115674_4365_5432 355
96 iso_pr_bacteria 2820332331 2820333598 355
97 3300042615 Ga0466711_268738 Ga0466711_268738_3051_4121 356
98 3300042620 Ga0466728_376755 Ga0466728_376755_4359_5435 358
99 3300042655 Ga0466727_064566 Ga0466727_064566_5944_7020 358
100 3300005071 Ga0068302_10004568 Ga0068302_100045689 359
101 3300042616 Ga0466715_021772 Ga0466715_021772_634_1716 360
102 3300042605 Ga0466716_169074 Ga0466716_169074_8978_10063 361
103 3300002462 JGI24702J35022_10008638 JGI24702J35022_100086382 362
104 3300010167 Ga0123353_10470935 Ga0123353_104709351 362
105 3300042594 Ga0466694_052549 Ga0466694_052549_4153_5241 362
106 3300042602 Ga0466713_049612 Ga0466713_049612_1838_2941 367
107 3300042617 Ga0466718_089500 Ga0466718_089500_2454_3557 367
108 3300042615 Ga0466711_152498 Ga0466711_152498_3057_4169 370

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 198 292 0.92
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 46 131 0.86
PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus 180 298 0.8
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 232 362 0.75

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.