Protein Family IF07487
Metagenome
Isolate
187
Members
53
Samples
181
Scaffolds
88.36
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_114808|Ga0466711_114808_14203_14529
- Length
- 108 aa
- Sequence
- LTWAAILYILNLNFAEKETEMSDLKQQIKELIVSALELEDIRPENIEDGAPIFGAGLGLDSIDALELGVALKKRFGVKFSAEGADNKRHFASVDALAAYIETAGSPAL
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.0%
Kalotermitidae
20.0%
Unclassified
16.0%
Termopsidae
6.0%
Rhinotermitidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
2
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 6 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 7 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 8 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 26 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 40 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 41 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 50 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_12385781 | 3300010049 | Bacteria | 662 |
| 2 | AustNasuHG_c1000619 | 3300000089 | Bacteria | 12570 |
| 3 | AustNasuHG_c1000765 | 3300000089 | Bacteria | 11444 |
| 4 | AustNasuHG_c1016910 | 3300000089 | Bacteria | 2434 |
| 5 | JGI24698J34947_10032439 | 3300002449 | Unclassified | 2743 |
| 6 | JGI24695J34938_10579429 | 3300002450 | Bacteria | 521 |
| 7 | JGI24697J35500_10915270 | 3300002507 | Bacteria | 826 |
| 8 | Ga0072940_1000661 | 3300005200 | Bacteria | 1913 |
| 9 | Ga0072941_1001332 | 3300005201 | Bacteria | 51552 |
| 10 | Ga0072941_1014101 | 3300005201 | Bacteria | 14074 |
| 11 | Ga0466730_071564 | 3300042625 | Unclassified | 1072 |
| 12 | Ga0466691_085608 | 3300042593 | Bacteria | 11814 |
| 13 | Ga0466720_032526 | 3300042607 | Bacteria | 10021 |
| 14 | Ga0466720_053074 | 3300042607 | Unclassified | 11065 |
| 15 | Ga0466720_070459 | 3300042607 | Bacteria | 9574 |
| 16 | Ga0466720_217425 | 3300042607 | Bacteria | 21579 |
| 17 | Ga0466722_072033 | 3300042609 | Bacteria | 4658 |
| 18 | Ga0466726_370708 | 3300042619 | Bacteria | 2399 |
| 19 | Ga0123355_10178783 | 3300009826 | Bacteria | 3154 |
| 20 | Ga0123353_10676620 | 3300010167 | Bacteria | 1454 |
| 21 | AustNasuHG_c1004450 | 3300000089 | Bacteria | 5023 |
| 22 | AustNasuHG_c1024327 | 3300000089 | Bacteria | 1920 |
| 23 | JGI24698J34947_10001349 | 3300002449 | Bacteria | 12899 |
| 24 | JGI24698J34947_10071796 | 3300002449 | Bacteria | 1660 |
| 25 | JGI24698J34947_10224711 | 3300002449 | Bacteria | 717 |
| 26 | JGI24698J34947_10245550 | 3300002449 | Bacteria | 672 |
| 27 | Ga0466704_505425 | 3300042643 | Bacteria | 3224 |
| 28 | Ga0466708_427103 | 3300042652 | Bacteria | 9472 |
| 29 | Ga0264413_124817 | 3300024493 | Unclassified | 2125 |
| 30 | Ga0466699_220548 | 3300042597 | Unclassified | 1355 |
| 31 | Ga0466706_238438 | 3300042599 | Unclassified | 1216 |
| 32 | Ga0466716_093157 | 3300042605 | Bacteria | 36386 |
| 33 | Ga0466722_195249 | 3300042609 | Bacteria | 2416 |
| 34 | Ga0466698_032932 | 3300042610 | Bacteria | 1096 |
| 35 | Ga0466698_456658 | 3300042610 | Bacteria | 1776 |
| 36 | Ga0466712_051799 | 3300042614 | Bacteria | 3196 |
| 37 | Ga0466712_277078 | 3300042614 | Bacteria | 5282 |
| 38 | Ga0466712_304795 | 3300042614 | Bacteria | 1132 |
| 39 | Ga0466711_114808 | 3300042615 | Bacteria | 18059 |
| 40 | Ga0466718_023427 | 3300042617 | Bacteria | 12924 |
| 41 | Ga0466718_107836 | 3300042617 | Bacteria | 1062 |
| 42 | Ga0466726_251100 | 3300042619 | Bacteria | 2529 |
| 43 | Ga0466726_363103 | 3300042619 | Bacteria | 1212 |
| 44 | Ga0123356_10532068 | 3300010049 | Bacteria | 1335 |
| 45 | Ga0123354_10691595 | 3300010882 | Bacteria | 715 |
| 46 | JGI24698J34947_10069781 | 3300002449 | Unclassified | 1694 |
| 47 | JGI24698J34947_10123428 | 3300002449 | Unclassified | 1119 |
| 48 | JGI24698J34947_10124781 | 3300002449 | Bacteria | 1111 |
| 49 | JGI24695J34938_10002227 | 3300002450 | Bacteria | 15057 |
| 50 | Ga0072941_1055941 | 3300005201 | Bacteria | 5692 |
| 51 | Ga0072941_1067832 | 3300005201 | Bacteria | 2402 |
| 52 | Ga0072941_1278405 | 3300005201 | Bacteria | 2466 |
| 53 | Ga0466704_131836 | 3300042643 | Bacteria | 2084 |
| 54 | Ga0466704_260065 | 3300042643 | Bacteria | 7786 |
| 55 | Ga0466727_001212 | 3300042655 | Bacteria | 2173 |
| 56 | Ga0466692_107501 | 3300042591 | Archaea | 10035 |
| 57 | Ga0466720_102668 | 3300042607 | Bacteria | 5497 |
| 58 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 59 | Ga0466712_149115 | 3300042614 | Bacteria | 2072 |
| 60 | Ga0466715_282209 | 3300042616 | Bacteria | 5538 |
| 61 | Ga0466718_005222 | 3300042617 | Bacteria | 8367 |
| 62 | Ga0466718_153599 | 3300042617 | Bacteria | 6864 |
| 63 | Ga0466718_161228 | 3300042617 | Bacteria | 5959 |
| 64 | Ga0466726_144346 | 3300042619 | Bacteria | 1856 |
| 65 | Ga0466732_341646 | 3300042656 | Bacteria | 2625 |
| 66 | Ga0123353_10989419 | 3300010167 | Unclassified | 1132 |
| 67 | Ga0123354_10983406 | 3300010882 | Bacteria | 544 |
| 68 | JGI24698J34947_10001633 | 3300002449 | Bacteria | 11937 |
| 69 | JGI24698J34947_10023170 | 3300002449 | Unclassified | 3322 |
| 70 | JGI24698J34947_10073792 | 3300002449 | Unclassified | 1627 |
| 71 | JGI24698J34947_10083124 | 3300002449 | Unclassified | 1495 |
| 72 | JGI24698J34947_10242742 | 3300002449 | Unclassified | 677 |
| 73 | JGI24695J34938_10000657 | 3300002450 | Bacteria | 32770 |
| 74 | Ga0072940_1004784 | 3300005200 | Bacteria | 2435 |
| 75 | Ga0072941_1000455 | 3300005201 | Bacteria | 18008 |
| 76 | Ga0072941_1001651 | 3300005201 | Unclassified | 3190 |
| 77 | Ga0466727_314942 | 3300042655 | Bacteria | 1607 |
| 78 | Ga0264413_113036 | 3300024493 | Bacteria | 15227 |
| 79 | Ga0466692_060286 | 3300042591 | Bacteria | 39383 |
| 80 | Ga0466692_061168 | 3300042591 | Bacteria | 10540 |
| 81 | Ga0466694_402821 | 3300042594 | Bacteria | 1064 |
| 82 | Ga0466695_317258 | 3300042595 | Bacteria | 1139 |
| 83 | Ga0466699_136670 | 3300042597 | Bacteria | 6936 |
| 84 | Ga0466699_173650 | 3300042597 | Bacteria | 20003 |
| 85 | Ga0466700_239872 | 3300042600 | Bacteria | 2259 |
| 86 | Ga0466707_013606 | 3300042601 | Bacteria | 3065 |
| 87 | Ga0466720_002785 | 3300042607 | Bacteria | 44479 |
| 88 | Ga0466720_003238 | 3300042607 | Bacteria | 32291 |
| 89 | Ga0466720_025415 | 3300042607 | Bacteria | 22188 |
| 90 | Ga0466720_045187 | 3300042607 | Bacteria | 27687 |
| 91 | Ga0466720_105231 | 3300042607 | Bacteria | 17684 |
| 92 | Ga0466712_014792 | 3300042614 | Bacteria | 30692 |
| 93 | Ga0466712_041313 | 3300042614 | Unclassified | 5132 |
| 94 | Ga0466718_016063 | 3300042617 | Bacteria | 36821 |
| 95 | Ga0466726_125150 | 3300042619 | Bacteria | 5080 |
| 96 | Ga0466733_001898 | 3300042659 | Bacteria | 3088 |
| 97 | Ga0123356_10020166 | 3300010049 | Bacteria | 6312 |
| 98 | Ga0123353_10311964 | 3300010167 | Unclassified | 2393 |
| 99 | Ga0123353_10401057 | 3300010167 | Bacteria | 2041 |
| 100 | Ga0123353_12258141 | 3300010167 | Unclassified | 656 |
| 101 | Ga0123354_10764084 | 3300010882 | Bacteria | 659 |
| 102 | AustNasuHG_c1001691 | 3300000089 | Bacteria | 7967 |
| 103 | JGI24698J34947_10048928 | 3300002449 | Bacteria | 2138 |
| 104 | JGI24695J34938_10000611 | 3300002450 | Bacteria | 34277 |
| 105 | JGI24695J34938_10121380 | 3300002450 | Bacteria | 1064 |
| 106 | JGI24697J35500_11107802 | 3300002507 | Unclassified | 1188 |
| 107 | JGI24696J40584_12754389 | 3300002834 | Bacteria | 799 |
| 108 | Ga0466703_091401 | 3300042636 | Bacteria | 67918 |
| 109 | Ga0466708_411860 | 3300042652 | Bacteria | 4954 |
| 110 | Ga0466699_120083 | 3300042597 | Bacteria | 1095 |
| 111 | Ga0466700_437567 | 3300042600 | Bacteria | 1136 |
| 112 | Ga0466719_119883 | 3300042606 | Bacteria | 32227 |
| 113 | Ga0466720_051968 | 3300042607 | Bacteria | 35380 |
| 114 | Ga0466720_138447 | 3300042607 | Bacteria | 2558 |
| 115 | Ga0466720_198340 | 3300042607 | Bacteria | 1026 |
| 116 | Ga0466712_034624 | 3300042614 | Bacteria | 10046 |
| 117 | Ga0466712_047576 | 3300042614 | Unclassified | 3047 |
| 118 | Ga0466718_125754 | 3300042617 | Bacteria | 3399 |
| 119 | Ga0466723_267389 | 3300042618 | Bacteria | 2855 |
| 120 | Ga0466726_410210 | 3300042619 | Bacteria | 1323 |
| 121 | Ga0123357_10227992 | 3300009784 | Bacteria | 2049 |
| 122 | Ga0123353_10007606 | 3300010167 | Bacteria | 14681 |
| 123 | Ga0123353_11315499 | 3300010167 | Unclassified | 937 |
| 124 | AustNasuHG_c1001821 | 3300000089 | Bacteria | 7710 |
| 125 | JGI24698J34947_10011091 | 3300002449 | Unclassified | 4945 |
| 126 | JGI24698J34947_10013976 | 3300002449 | Unclassified | 4375 |
| 127 | JGI24698J34947_10042582 | 3300002449 | Unclassified | 2332 |
| 128 | JGI24696J40584_12940664 | 3300002834 | Unclassified | 1684 |
| 129 | Ga0072940_1248889 | 3300005200 | Bacteria | 593 |
| 130 | Ga0072941_1030163 | 3300005201 | Bacteria | 5025 |
| 131 | Ga0466734_054236 | 3300042623 | Bacteria | 1055 |
| 132 | Ga0466735_034093 | 3300042624 | Bacteria | 1969 |
| 133 | Ga0466727_223256 | 3300042655 | Bacteria | 2548 |
| 134 | Ga0466691_063132 | 3300042593 | Bacteria | 13644 |
| 135 | Ga0466699_093050 | 3300042597 | Bacteria | 10576 |
| 136 | Ga0466701_062958 | 3300042598 | Bacteria | 1165 |
| 137 | Ga0466713_093051 | 3300042602 | Bacteria | 6833 |
| 138 | Ga0466720_213041 | 3300042607 | Bacteria | 2185 |
| 139 | Ga0466722_145382 | 3300042609 | Bacteria | 1951 |
| 140 | Ga0466712_139706 | 3300042614 | Bacteria | 19549 |
| 141 | Ga0466712_162475 | 3300042614 | Bacteria | 12452 |
| 142 | Ga0466712_204469 | 3300042614 | Bacteria | 34311 |
| 143 | Ga0466712_253361 | 3300042614 | Bacteria | 30767 |
| 144 | Ga0466712_271233 | 3300042614 | Bacteria | 3175 |
| 145 | Ga0466715_117125 | 3300042616 | Bacteria | 8552 |
| 146 | Ga0466718_034018 | 3300042617 | Bacteria | 1180 |
| 147 | Ga0466718_064191 | 3300042617 | Bacteria | 1507 |
| 148 | Ga0466718_122256 | 3300042617 | Bacteria | 26403 |
| 149 | Ga0466726_068834 | 3300042619 | Bacteria | 5177 |
| 150 | Ga0466732_368313 | 3300042656 | Bacteria | 6284 |
| 151 | Ga0123353_10424412 | 3300010167 | Bacteria | 1969 |
| 152 | AustNasuHG_c1007134 | 3300000089 | Bacteria | 3982 |
| 153 | FAAS_10827875 | 3300001880 | Bacteria | 523 |
| 154 | JGI24698J34947_10000471 | 3300002449 | Bacteria | 18816 |
| 155 | JGI24698J34947_10007557 | 3300002449 | Bacteria | 5971 |
| 156 | JGI24698J34947_10030521 | 3300002449 | Bacteria | 2842 |
| 157 | JGI24695J34938_10112296 | 3300002450 | Bacteria | 1110 |
| 158 | Ga0072940_1044666 | 3300005200 | Unclassified | 2563 |
| 159 | Ga0466707_071113 | 3300042601 | Archaea | 1183 |
| 160 | Ga0466720_022958 | 3300042607 | Bacteria | 5494 |
| 161 | Ga0466722_234569 | 3300042609 | Bacteria | 3504 |
| 162 | Ga0466712_175017 | 3300042614 | Bacteria | 45826 |
| 163 | Ga0466718_070080 | 3300042617 | Unclassified | 1437 |
| 164 | Ga0466718_166483 | 3300042617 | Bacteria | 4599 |
| 165 | Ga0466726_270950 | 3300042619 | Bacteria | 1152 |
| 166 | Ga0466728_061587 | 3300042620 | Unclassified | 1038 |
| 167 | Ga0123354_10721821 | 3300010882 | Bacteria | 690 |
| 168 | JGI24695J34938_10003792 | 3300002450 | Bacteria | 10293 |
| 169 | JGI24695J34938_10105951 | 3300002450 | Unclassified | 1147 |
| 170 | JGI24702J35022_10810362 | 3300002462 | Bacteria | 583 |
| 171 | JGI24705J35276_12220086 | 3300002504 | Bacteria | 2244 |
| 172 | JGI24696J40584_12907641 | 3300002834 | Bacteria | 1230 |
| 173 | Ga0466727_000438 | 3300042655 | Bacteria | 5008 |
| 174 | Ga0466727_189803 | 3300042655 | Bacteria | 15151 |
| 175 | Ga0466727_341417 | 3300042655 | Bacteria | 1843 |
| 176 | Ga0264413_103944 | 3300024493 | Unclassified | 3041 |
| 177 | Ga0466699_178162 | 3300042597 | Bacteria | 26425 |
| 178 | Ga0466720_098286 | 3300042607 | Unclassified | 2958 |
| 179 | Ga0466712_261810 | 3300042614 | Bacteria | 1017 |
| 180 | Ga0466718_038059 | 3300042617 | Bacteria | 14472 |
| 181 | Ga0466726_133443 | 3300042619 | Bacteria | 1063 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00550 | PP-binding | Phosphopantetheine attachment site | 26 | 82 | 0.79 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.