Protein Family IF07462
Metagenome
Isolate
118
Members
33
Samples
116
Scaffolds
127.77
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_055069|Ga0466711_055069_526_966
- Length
- 146 aa
- Sequence
- MSVSYVIVQRGNPGNPEAPKKFYAQAKSRGELTFRKLSKEIAEGSTTVSDTDVLAVLNDLTKVLKRHLDNGEIVRFGDFGTFQVGISSEGAETEAKFHSSLIKNPKVVFRPGIDLKEMLATLKYEKVFPVVPTTNPKADELLKKDK
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.6%
Termitidae
25.0%
Termopsidae
9.4%
Unclassified
9.4%
Passalidae
6.2%
Rhinotermitidae
6.2%
Blattidae
3.1%
Taxonomy
Archaea
0
Bacteria
101
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 10 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 11 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 12 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 13 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_051098 | 3300042612 | Bacteria | 9320 |
| 2 | Ga0466715_345237 | 3300042616 | Unclassified | 4768 |
| 3 | Ga0466715_623390 | 3300042616 | Unclassified | 2026 |
| 4 | Ga0466707_090859 | 3300042601 | Bacteria | 7347 |
| 5 | 2227571863 | 2225789004 | Bacteria | 13781 |
| 6 | Ga0068302_10054757 | 3300005071 | Bacteria | 5505 |
| 7 | Ga0072941_1333228 | 3300005201 | Bacteria | 1775 |
| 8 | Ga0466703_105658 | 3300042636 | Unclassified | 14860 |
| 9 | Ga0466703_106708 | 3300042636 | Bacteria | 11343 |
| 10 | Ga0466703_197933 | 3300042636 | Bacteria | 2388 |
| 11 | Ga0466703_260797 | 3300042636 | Bacteria | 4494 |
| 12 | Ga0466709_129172 | 3300042648 | Bacteria | 9385 |
| 13 | Ga0466709_314545 | 3300042648 | Bacteria | 211401 |
| 14 | Ga0466708_081730 | 3300042652 | Bacteria | 1236 |
| 15 | Ga0466708_119530 | 3300042652 | Unclassified | 1864 |
| 16 | Ga0466725_405811 | 3300042654 | Bacteria | 1057 |
| 17 | Ga0466690_409593 | 3300042590 | Bacteria | 1293 |
| 18 | Ga0466733_210672 | 3300042659 | Bacteria | 1783 |
| 19 | Ga0466711_171608 | 3300042615 | Bacteria | 5779 |
| 20 | Ga0466715_251195 | 3300042616 | Unclassified | 2958 |
| 21 | Ga0466723_230674 | 3300042618 | Bacteria | 2503 |
| 22 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 23 | Ga0466707_123089 | 3300042601 | Bacteria | 1324 |
| 24 | Ga0466707_191226 | 3300042601 | Bacteria | 1054 |
| 25 | Ga0466717_267201 | 3300042604 | Bacteria | 1910 |
| 26 | IMNBL1DRAFT_c0094036 | 3300000062 | Unclassified | 816 |
| 27 | Ga0466703_177766 | 3300042636 | Bacteria | 2360 |
| 28 | Ga0466692_078489 | 3300042591 | Bacteria | 4311 |
| 29 | Ga0466692_111305 | 3300042591 | Bacteria | 1159 |
| 30 | Ga0466705_234984 | 3300042612 | Bacteria | 2039 |
| 31 | Ga0466711_025529 | 3300042615 | Bacteria | 4969 |
| 32 | Ga0466711_055069 | 3300042615 | Bacteria | 1183 |
| 33 | Ga0466711_249393 | 3300042615 | Bacteria | 3810 |
| 34 | Ga0466728_474307 | 3300042620 | Bacteria | 3700 |
| 35 | Ga0466707_149665 | 3300042601 | Bacteria | 15393 |
| 36 | Ga0466716_195956 | 3300042605 | Unclassified | 3049 |
| 37 | IMNBL1DRAFT_c0092744 | 3300000062 | Bacteria | 825 |
| 38 | Ga0466708_265369 | 3300042652 | Bacteria | 10590 |
| 39 | Ga0466708_271898 | 3300042652 | Unclassified | 4867 |
| 40 | Ga0466708_403438 | 3300042652 | Bacteria | 4480 |
| 41 | Ga0466732_329036 | 3300042656 | Bacteria | 1506 |
| 42 | Ga0466733_109699 | 3300042659 | Bacteria | 1766 |
| 43 | Ga0466707_175216 | 3300042601 | Unclassified | 5106 |
| 44 | Ga0466713_035223 | 3300042602 | Bacteria | 4485 |
| 45 | Ga0466713_127438 | 3300042602 | Bacteria | 6165 |
| 46 | Ga0466719_273722 | 3300042606 | Bacteria | 4777 |
| 47 | Ga0466722_213529 | 3300042609 | Bacteria | 2327 |
| 48 | 2227538535 | 2225789004 | Bacteria | 15745 |
| 49 | IMNBL1DRAFT_c0009097 | 3300000062 | Bacteria | 4963 |
| 50 | JGI24696J40584_12934929 | 3300002834 | Unclassified | 1549 |
| 51 | Ga0466704_521785 | 3300042643 | Bacteria | 2980 |
| 52 | Ga0466708_357683 | 3300042652 | Bacteria | 12095 |
| 53 | Ga0466708_381469 | 3300042652 | Bacteria | 6607 |
| 54 | Ga0466690_118212 | 3300042590 | Bacteria | 7212 |
| 55 | Ga0466690_278512 | 3300042590 | Bacteria | 2385 |
| 56 | Ga0466696_240292 | 3300042596 | Bacteria | 3054 |
| 57 | Ga0466733_055155 | 3300042659 | Bacteria | 3699 |
| 58 | Ga0466711_158974 | 3300042615 | Unclassified | 6366 |
| 59 | Ga0466715_265229 | 3300042616 | Bacteria | 4530 |
| 60 | Ga0466715_285360 | 3300042616 | Bacteria | 7998 |
| 61 | Ga0466723_088373 | 3300042618 | Bacteria | 1635 |
| 62 | Ga0466707_105454 | 3300042601 | Bacteria | 2907 |
| 63 | 2227165831 | 2225789004 | Bacteria | 1539 |
| 64 | IMNBL1DRAFT_c0000933 | 3300000062 | Bacteria | 22594 |
| 65 | IMNBL1DRAFT_c0001288 | 3300000062 | Bacteria | 18888 |
| 66 | JGI24702J35022_10339671 | 3300002462 | Bacteria | 895 |
| 67 | Ga0466703_114207 | 3300042636 | Bacteria | 11466 |
| 68 | Ga0466709_406939 | 3300042648 | Bacteria | 144693 |
| 69 | Ga0466708_097064 | 3300042652 | Unclassified | 5348 |
| 70 | Ga0123356_11615798 | 3300010049 | Bacteria | 802 |
| 71 | Ga0466711_259143 | 3300042615 | Bacteria | 5045 |
| 72 | Ga0466723_247958 | 3300042618 | Bacteria | 1151 |
| 73 | Ga0466716_149971 | 3300042605 | Bacteria | 2805 |
| 74 | IMNBL1DRAFT_c0050693 | 3300000062 | Bacteria | 1313 |
| 75 | JGI24702J35022_10000324 | 3300002462 | Bacteria | 28237 |
| 76 | Ga0068302_10008227 | 3300005071 | Bacteria | 3044 |
| 77 | Ga0466727_021420 | 3300042655 | Bacteria | 3125 |
| 78 | Ga0466690_059873 | 3300042590 | Bacteria | 1701 |
| 79 | Ga0466690_267807 | 3300042590 | Bacteria | 3178 |
| 80 | Ga0466696_044008 | 3300042596 | Bacteria | 4906 |
| 81 | Ga0466696_048401 | 3300042596 | Unclassified | 4789 |
| 82 | Ga0466696_107781 | 3300042596 | Bacteria | 2588 |
| 83 | Ga0466705_071601 | 3300042612 | Bacteria | 2089 |
| 84 | Ga0466733_018031 | 3300042659 | Bacteria | 8919 |
| 85 | Ga0466733_030390 | 3300042659 | Bacteria | 8372 |
| 86 | Ga0466733_139821 | 3300042659 | Bacteria | 12988 |
| 87 | Ga0466711_131018 | 3300042615 | Bacteria | 37915 |
| 88 | Ga0466715_310361 | 3300042616 | Bacteria | 7425 |
| 89 | Ga0466723_024120 | 3300042618 | Bacteria | 1722 |
| 90 | Ga0466723_276654 | 3300042618 | Bacteria | 1920 |
| 91 | Ga0466728_101703 | 3300042620 | Bacteria | 5508 |
| 92 | Ga0466713_027405 | 3300042602 | Bacteria | 1601 |
| 93 | Ga0466719_418549 | 3300042606 | Bacteria | 1164 |
| 94 | Ga0466703_180988 | 3300042636 | Bacteria | 4567 |
| 95 | Ga0466703_407109 | 3300042636 | Bacteria | 1071 |
| 96 | Ga0466704_113504 | 3300042643 | Bacteria | 13015 |
| 97 | Ga0466704_162306 | 3300042643 | Bacteria | 7066 |
| 98 | Ga0466704_204890 | 3300042643 | Bacteria | 5024 |
| 99 | Ga0466704_613721 | 3300042643 | Bacteria | 3372 |
| 100 | Ga0466708_316176 | 3300042652 | Unclassified | 1176 |
| 101 | Ga0466690_132435 | 3300042590 | Bacteria | 16004 |
| 102 | Ga0466690_269685 | 3300042590 | Bacteria | 7441 |
| 103 | Ga0466696_292894 | 3300042596 | Unclassified | 1669 |
| 104 | Ga0466732_211184 | 3300042656 | Bacteria | 1631 |
| 105 | Ga0466733_066441 | 3300042659 | Unclassified | 1814 |
| 106 | Ga0466733_162458 | 3300042659 | Bacteria | 7480 |
| 107 | Ga0466711_370994 | 3300042615 | Bacteria | 1601 |
| 108 | Ga0466715_025302 | 3300042616 | Bacteria | 5206 |
| 109 | Ga0466715_068298 | 3300042616 | Unclassified | 4189 |
| 110 | Ga0466715_084575 | 3300042616 | Bacteria | 5539 |
| 111 | Ga0466717_158878 | 3300042604 | Bacteria | 1748 |
| 112 | Ga0466722_239488 | 3300042609 | Bacteria | 1535 |
| 113 | Ga0466703_138591 | 3300042636 | Bacteria | 12628 |
| 114 | Ga0466704_313169 | 3300042643 | Bacteria | 5281 |
| 115 | Ga0466704_475673 | 3300042643 | Bacteria | 25542 |
| 116 | Ga0466656_222238 | 3300042550 | Bacteria | 2020 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.