Protein Family IF07449

Metagenome Isolate
172 Members
85 Samples
126 Scaffolds
441.72 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_015225|Ga0466711_015225_13447_14997
Length
504 aa
Sequence
MLFSNNSFAAFLLSGFEYEKTGEKMMKAKDSICRCADEAKRFVTDDCCLLFIIDKSRIIILTKFVIFGMIKRNSMNWQQLLSVKRFGMDFQRDYDRLVFSSPFRRLQNKTQVFPLPGSVFVHNRLTHSIEVSCVGRSLGMVVGRELRKKYPDSGADFEEISSIVAAGCLAHDLGNPPFGHSGEKAITSYFSEGKGKYLEKKVRQEGGRWEDFTNFEGNANSIRMLIHQFNGRRPGGFVMTYSMLASIVKYPYSALAANDKGKFGFFQAEENDFRKIADELGMACMQESPLRYARHPLVYLVEAADDICYKIMDIEDAHKLGLLSTEQTINLFMNFFPEERQMEMHRTMDRVNDINEQIAYLRSSVIGLLVGECTAVFLENEKPVLEGRFEDALVKHISPLPNKAHKEATDTSYKKIYKTKDVVDIELAGHRIIGFLLDTFITAIENPEAKYSELILSRVPEQFEKDAPTLYGRILAILDFVSGMTDVYALDLYRKITGMSLPTV

📊 Sample Types

Isolate 26.7%
Metagenome 73.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 40.0%
Kalotermitidae 16.5%
Termitidae 12.9%
Unclassified 11.8%
Rhinotermitidae 4.7%
Termopsidae 4.7%
Passalidae 3.5%
Hydrophilidae 2.4%
Hodotermitidae 1.2%
Culicidae 1.2%
Tenebrionidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 166
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
2 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
3 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 2922326829 Bacteroides sp. 224 Isolate Blattidae
13 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
14 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
15 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
20 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
25 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
26 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
27 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
32 3004672520 Bacteroides sp. 51 Isolate Blattidae
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
35 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
36 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
37 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
38 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
39 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
40 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
41 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
42 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
43 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
48 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
49 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
50 2920168565 Paludibacter sp. 221 Isolate Blattidae
51 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
52 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
53 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
54 3004667792 Bacteroides sp. 519 Isolate Blattidae
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
57 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
58 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
59 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
60 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
61 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
62 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
63 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
64 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
65 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
66 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
67 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
68 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
69 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
70 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
71 2923982719 Parabacteroides sp. 52 Isolate Blattidae
72 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
73 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
74 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
75 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
76 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
77 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
78 3004677695 Bacteroides sp. 214 Isolate Blattidae
79 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
80 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
81 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
82 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
83 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
84 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
85 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_053829 3300042659 Bacteria 74295
2 Ga0466733_125763 3300042659 Bacteria 4828
3 Ga0466713_050170 3300042602 Bacteria 4532
4 Ga0466713_060148 3300042602 Bacteria 9794
5 Ga0466713_133388 3300042602 Bacteria 4493
6 Ga0466716_225187 3300042605 Bacteria 1875
7 Ga0466711_015225 3300042615 Bacteria 21110
8 Ga0466728_236110 3300042620 Bacteria 1302
9 Ga0466691_205598 3300042593 Bacteria 20201
10 Ga0466696_199566 3300042596 Bacteria 9051
11 Ga0466703_202228 3300042636 Bacteria 12788
12 Ga0466709_138818 3300042648 Bacteria 98089
13 Ga0466727_059128 3300042655 Bacteria 2210
14 Ga0466706_082173 3300042599 Bacteria 21336
15 Ga0466706_130182 3300042599 Bacteria 5359
16 Ga0466706_268279 3300042599 Bacteria 5694
17 Ga0466716_163384 3300042605 Bacteria 16200
18 Ga0466711_092050 3300042615 Bacteria 33984
19 Ga0466715_118628 3300042616 Bacteria 6566
20 Ga0466715_247902 3300042616 Bacteria 8227
21 Ga0466715_468183 3300042616 Unclassified 6882
22 Ga0466715_491159 3300042616 Bacteria 21907
23 Ga0466728_386665 3300042620 Bacteria 55152
24 Ga0466690_217857 3300042590 Bacteria 7588
25 Ga0466690_246794 3300042590 Bacteria 1923
26 Ga0466696_180262 3300042596 Bacteria 6435
27 2227555165 2225789004 Bacteria 14888
28 Ga0068305_10124034 3300005083 Unclassified 9144
29 Ga0466735_222452 3300042624 Bacteria 3844
30 Ga0466708_289889 3300042652 Unclassified 12729
31 Ga0466705_000780 3300042612 Bacteria 13087
32 Ga0466705_102081 3300042612 Bacteria 2036
33 Ga0562377_0004 3300056842 Bacteria 3525959
34 Ga0466713_105837 3300042602 Bacteria 22694
35 Ga0466713_107023 3300042602 Bacteria 9055
36 Ga0466713_151406 3300042602 Bacteria 82944
37 Ga0466711_040811 3300042615 Bacteria 5309
38 Ga0466715_030319 3300042616 Bacteria 43703
39 Ga0466715_078429 3300042616 Bacteria 21717
40 Ga0466691_041731 3300042593 Bacteria 9611
41 Ga0466696_010174 3300042596 Bacteria 34499
42 Ga0466696_101849 3300042596 Bacteria 13014
43 2226988721 2225789003 Bacteria 7427
44 Ga0466730_065558 3300042625 Bacteria 4366
45 Ga0466704_161134 3300042643 Bacteria 14622
46 Ga0466714_073904 3300042603 Bacteria 61298
47 Ga0466714_085794 3300042603 Bacteria 15566
48 Ga0466716_415147 3300042605 Bacteria 4391
49 Ga0466723_116408 3300042618 Unclassified 13439
50 Ga0466723_184325 3300042618 Bacteria 7069
51 Ga0466723_336862 3300042618 Bacteria 51262
52 Ga0466690_022456 3300042590 Bacteria 6122
53 Ga0466690_053388 3300042590 Bacteria 18157
54 IMNBL1DRAFT_c0006888 3300000062 Unclassified 6098
55 JGI24699J35502_11134197 3300002509 Bacteria 52215
56 Ga0068305_10003755 3300005083 Bacteria 24137
57 Ga0466703_273901 3300042636 Bacteria 9273
58 Ga0466704_242471 3300042643 Bacteria 6401
59 Ga0466709_106314 3300042648 Bacteria 11901
60 Ga0466727_308122 3300042655 Bacteria 9450
61 Ga0466733_004168 3300042659 Bacteria 3814
62 Ga0466706_288090 3300042599 Bacteria 45915
63 Ga0466713_106733 3300042602 Bacteria 4987
64 Ga0466719_023176 3300042606 Bacteria 5841
65 Ga0466697_056567 3300042611 Bacteria 485126
66 Ga0466715_175307 3300042616 Bacteria 2018
67 Ga0466728_077048 3300042620 Bacteria 8986
68 IMNBL1DRAFT_c0000550 3300000062 Bacteria 30486
69 Ga0466709_082215 3300042648 Bacteria 9766
70 Ga0466708_030500 3300042652 Bacteria 7885
71 Ga0466708_415351 3300042652 Bacteria 15043
72 Ga0466727_047493 3300042655 Bacteria 11773
73 Ga0466733_065312 3300042659 Bacteria 101833
74 Ga0466706_155311 3300042599 Bacteria 8025
75 Ga0466706_178083 3300042599 Bacteria 37293
76 Ga0466713_018544 3300042602 Bacteria 4583
77 Ga0466713_129716 3300042602 Bacteria 104954
78 Ga0466716_494853 3300042605 Bacteria 13730
79 Ga0466719_228621 3300042606 Bacteria 11972
80 Ga0466722_032792 3300042609 Bacteria 5748
81 Ga0466722_180482 3300042609 Bacteria 8683
82 Ga0466711_049821 3300042615 Bacteria 2549
83 Ga0466715_271424 3300042616 Bacteria 5165
84 Ga0466715_604674 3300042616 Bacteria 12222
85 Ga0466726_091607 3300042619 Bacteria 8660
86 Ga0466726_117593 3300042619 Bacteria 2654
87 Ga0466690_430761 3300042590 Bacteria 14184
88 Ga0466695_194986 3300042595 Bacteria 3990
89 2227080821 2225789004 Bacteria 10122
90 IMNBL1DRAFT_c0019475 3300000062 Bacteria 2777
91 JGI24702J35022_10048756 3300002462 Bacteria 2255
92 Ga0123357_10001423 3300009784 Bacteria 25372
93 Ga0466735_120001 3300042624 Bacteria 6566
94 Ga0466703_167702 3300042636 Bacteria 5571
95 Ga0466703_382219 3300042636 Bacteria 2562
96 Ga0466724_32287 3300042649 Bacteria 2043
97 Ga0466725_114163 3300042654 Bacteria 7975
98 Ga0466697_087648 3300042611 Bacteria 2446
99 Ga0466733_119077 3300042659 Bacteria 2327
100 Ga0466733_134600 3300042659 Bacteria 1956
101 Ga0466706_053659 3300042599 Bacteria 18450
102 Ga0466716_098687 3300042605 Bacteria 12386
103 Ga0466722_083934 3300042609 Bacteria 2042
104 Ga0123357_10071973 3300009784 Bacteria 4583
105 Ga0160460_100002 3300012845 Bacteria 833437
106 IMNBL1DRAFT_c0003781 3300000062 Bacteria 9463
107 IMNBL1DRAFT_c0012132 3300000062 Bacteria 3964
108 Ga0068302_10199549 3300005071 Unclassified 4166
109 Ga0068305_10030988 3300005083 Bacteria 9342
110 Ga0466735_099330 3300042624 Bacteria 1784
111 Ga0466708_461800 3300042652 Bacteria 46167
112 Ga0466733_031111 3300042659 Bacteria 44698
113 Ga0466733_059945 3300042659 Bacteria 11444
114 Ga0466733_118635 3300042659 Bacteria 2165
115 Ga0466700_164572 3300042600 Bacteria 2438
116 Ga0466707_123401 3300042601 Bacteria 6795
117 Ga0466707_354114 3300042601 Bacteria 5164
118 Ga0466713_099183 3300042602 Bacteria 118109
119 Ga0466715_540931 3300042616 Bacteria 8372
120 Ga0466723_149381 3300042618 Bacteria 17438
121 Ga0466690_033397 3300042590 Bacteria 5539
122 Ga0466696_228385 3300042596 Bacteria 15316
123 Ga0466703_112835 3300042636 Bacteria 11705
124 Ga0466704_561838 3300042643 Bacteria 29338
125 Ga0466725_320152 3300042654 Bacteria 12291
126 Ga0466727_178574 3300042655 Bacteria 4997

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01966 HD HD domain 124 211 0.84
PF13286 HD_assoc Phosphohydrolase-associated domain 409 495 0.74

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.