Protein Family IF07426

Metagenome Isolate
167 Members
66 Samples
151 Scaffolds
450.08 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_287903|Ga0466712_287903_533_2140
Length
524 aa
Sequence
MKSKTKPIENQNVEWKESWRDDYLKWICGFANAQGGKLELGRSDKGVLVGLPDAKRLLEDLPNKIRTTMGIVADVNLRRKDGFEYIVIDIAPYSNAISYRGKYYLRSGSTNQELTSFALDELILRKYGRTWDSAPVPRVNINDFYNDAFDIFRKKAVSSRRLTPEDVAVSNEQLLKILRLTEGDYLLKSALMLFHQDTEQWCFGSYVKIGYFENDADLLYQDEIGGSLIGIADRVMDTIYTKYLKGIIRYEGIQRIDHYPIPQNVLREAVLNAIVHKDYSTGNPIHIKIYDDKIVIYNDCRLPSNTLPENLLNGIGSRPHNPLIAGTFFRSGQIEAWGRGIEKMKNDCIKDALPEPEFNILPNMFSICFLIHKDNSQNYNNDPINENSYNIKGTENQLLMLNNIAKNPRITITELASIVGISASKIKKNIAKLKEKGLIERIGADKGGYWKLCNDPISDNIKGTENQQLILTNIAQNPYITINELASIVGISASKIKENIAKLKDKGLIERIGADKGGYWKLRQ

📊 Sample Types

Isolate 9.6%
Metagenome 90.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.5%
Unclassified 26.2%
Kalotermitidae 21.5%
Rhinotermitidae 4.6%
Termopsidae 4.6%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 5
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
2 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
3 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
6 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
11 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
12 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
15 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 2772191001 Unclassified Bathyarchaeota Th196P4bin19 Isolate Unclassified
27 2819999932 Unclassified Synergistetes Th196P4bin51 Isolate Unclassified
28 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
31 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
37 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
38 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
48 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
53 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
54 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
55 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
56 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
57 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
58 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
59 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
60 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
61 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
62 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
63 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
64 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10028842 3300002449 Unclassified 2937
2 Ga0068302_10030014 3300005071 Bacteria 3976
3 Ga0466711_342569 3300042615 Bacteria 14719
4 Ga0466715_437218 3300042616 Bacteria 2341
5 Ga0466723_163769 3300042618 Bacteria 7261
6 Ga0466729_068906 3300042621 Bacteria 1900
7 Ga0466700_233862 3300042600 Bacteria 32871
8 Ga0466700_475226 3300042600 Bacteria 1474
9 Ga0466692_022583 3300042591 Bacteria 8703
10 Ga0466734_073830 3300042623 Bacteria 3796
11 Ga0466704_506007 3300042643 Bacteria 1904
12 Ga0466704_593648 3300042643 Bacteria 44691
13 Ga0123356_10205046 3300010049 Bacteria 2015
14 Ga0123356_10238191 3300010049 Bacteria 1889
15 JGI24702J35022_10032324 3300002462 Bacteria 2803
16 Ga0123357_10000434 3300009784 Bacteria 40221
17 Ga0466705_070299 3300042612 Bacteria 9406
18 Ga0466712_287903 3300042614 Bacteria 2385
19 Ga0466711_056060 3300042615 Bacteria 9575
20 Ga0466711_332692 3300042615 Bacteria 2906
21 Ga0466715_210609 3300042616 Bacteria 7603
22 Ga0466706_283361 3300042599 Bacteria 1739
23 Ga0466713_128590 3300042602 Bacteria 2528
24 Ga0466717_101443 3300042604 Bacteria 18306
25 Ga0466719_530064 3300042606 Bacteria 3723
26 Ga0466693_215130 3300042592 Bacteria 1858
27 Ga0466696_208883 3300042596 Archaea 2578
28 Ga0466699_293486 3300042597 Bacteria 5085
29 Ga0466702_013605 3300042635 Bacteria 6499
30 Ga0466704_098808 3300042643 Bacteria 4676
31 Ga0466708_308722 3300042652 Bacteria 19597
32 Ga0466708_356703 3300042652 Bacteria 8863
33 Ga0123355_10008885 3300009826 Bacteria 15215
34 Ga0123355_10068038 3300009826 Bacteria 5731
35 Ga0123356_10001915 3300010049 Bacteria 22556
36 Ga0123353_10382787 3300010167 Bacteria 2103
37 JGI24696J40584_12946661 3300002834 Unclassified 1910
38 Ga0068305_10037251 3300005083 Bacteria 9038
39 Ga0466705_095573 3300042612 Bacteria 10439
40 Ga0466732_119516 3300042656 Bacteria 1858
41 Ga0466705_468840 3300042612 Bacteria 3139
42 Ga0466712_005899 3300042614 Bacteria 24210
43 Ga0466712_056882 3300042614 Bacteria 3530
44 Ga0466711_003505 3300042615 Bacteria 2180
45 Ga0466711_063034 3300042615 Bacteria 7452
46 Ga0466715_124576 3300042616 Bacteria 9222
47 Ga0466726_136198 3300042619 Bacteria 33253
48 Ga0466707_031179 3300042601 Bacteria 18797
49 Ga0466717_150904 3300042604 Bacteria 2330
50 Ga0466716_035366 3300042605 Bacteria 2924
51 Ga0466716_487231 3300042605 Bacteria 3137
52 Ga0466720_011473 3300042607 Bacteria 1838
53 Ga0466722_124388 3300042609 Bacteria 2726
54 Ga0415639_004643 3300038395 Bacteria 37820
55 Ga0466693_063589 3300042592 Bacteria 2075
56 Ga0466691_006210 3300042593 Unclassified 5812
57 Ga0466696_192278 3300042596 Bacteria 4059
58 Ga0466699_161508 3300042597 Bacteria 3934
59 Ga0466703_031525 3300042636 Bacteria 23082
60 Ga0123356_10103855 3300010049 Bacteria 2731
61 Ga0123353_10002069 3300010167 Bacteria 24793
62 Ga0123353_10020725 3300010167 Bacteria 9836
63 Ga0123353_10405740 3300010167 Bacteria 2026
64 Ga0466705_309828 3300042612 Bacteria 1620
65 Ga0466705_381672 3300042612 Bacteria 13966
66 Ga0466733_026128 3300042659 Bacteria 24277
67 Ga0466705_488191 3300042612 Bacteria 6736
68 Ga0466715_291678 3300042616 Bacteria 1960
69 Ga0466718_024929 3300042617 Bacteria 14465
70 Ga0466718_027078 3300042617 Bacteria 3159
71 Ga0466728_403123 3300042620 Unclassified 1494
72 Ga0466728_440214 3300042620 Unclassified 2330
73 Ga0466720_094584 3300042607 Bacteria 3063
74 Ga0466691_008920 3300042593 Bacteria 6848
75 Ga0466699_110137 3300042597 Bacteria 1386
76 Ga0466704_142201 3300042643 Unclassified 11034
77 Ga0466704_337788 3300042643 Bacteria 24756
78 Ga0123356_10280653 3300010049 Bacteria 1761
79 Ga0123353_10167089 3300010167 Bacteria 3496
80 AustNasuHG_c1014715 3300000089 Unclassified 2652
81 JGI24702J35022_10000668 3300002462 Bacteria 20836
82 JGI24702J35022_10006276 3300002462 Bacteria 6878
83 Ga0466732_283510 3300042656 Bacteria 3534
84 Ga0466718_020982 3300042617 Bacteria 3168
85 Ga0466706_027362 3300042599 Bacteria 3660
86 Ga0466717_117544 3300042604 Bacteria 2205
87 Ga0466721_062284 3300042608 Bacteria 88037
88 Ga0466722_057118 3300042609 Bacteria 9798
89 Ga0466690_281470 3300042590 Bacteria 2282
90 Ga0466692_165073 3300042591 Bacteria 238196
91 Ga0466702_410205 3300042635 Bacteria 3647
92 Ga0466708_047886 3300042652 Bacteria 19239
93 Ga0123355_10180479 3300009826 Bacteria 3134
94 Ga0123354_10075272 3300010882 Bacteria 4829
95 JGI24705J35276_12230721 3300002504 Bacteria 3710
96 Ga0466712_322848 3300042614 Bacteria 1611
97 Ga0466728_233009 3300042620 Bacteria 2454
98 Ga0466729_093264 3300042621 Bacteria 6658
99 Ga0466713_109697 3300042602 Bacteria 6805
100 Ga0466713_122637 3300042602 Unclassified 3787
101 Ga0466713_149566 3300042602 Bacteria 24500
102 Ga0466716_351938 3300042605 Unclassified 3042
103 Ga0466719_358926 3300042606 Bacteria 16987
104 Ga0466720_141207 3300042607 Bacteria 4390
105 Ga0466698_275499 3300042610 Bacteria 1769
106 Ga0264413_105265 3300024493 Bacteria 7974
107 Ga0466690_132803 3300042590 Bacteria 2445
108 Ga0466691_108695 3300042593 Bacteria 1884
109 Ga0466696_138496 3300042596 Bacteria 2256
110 Ga0466699_052049 3300042597 Bacteria 1709
111 Ga0466702_009442 3300042635 Bacteria 5622
112 Ga0466703_020846 3300042636 Bacteria 3925
113 Ga0466703_243961 3300042636 Bacteria 33123
114 Ga0466704_117779 3300042643 Bacteria 2828
115 Ga0466709_204549 3300042648 Bacteria 3261
116 Ga0466724_68643 3300042649 Bacteria 15926
117 Ga0123356_10000035 3300010049 Bacteria 145473
118 Ga0123353_10039063 3300010167 Archaea 7466
119 Ga0123354_10285644 3300010882 Bacteria 1592
120 JGI24698J34947_10079811 3300002449 Archaea 1539
121 JGI24702J35022_10002609 3300002462 Bacteria 10944
122 JGI24702J35022_10066690 3300002462 Bacteria 1932
123 Ga0466705_196474 3300042612 Bacteria 2832
124 Ga0466705_246365 3300042612 Bacteria 2130
125 Ga0466710_113359 3300042613 Bacteria 3581
126 Ga0466718_116825 3300042617 Bacteria 11670
127 Ga0466729_144255 3300042621 Unclassified 4005
128 Ga0466716_240462 3300042605 Bacteria 3499
129 Ga0466716_459060 3300042605 Bacteria 3064
130 Ga0466719_443311 3300042606 Bacteria 2352
131 Ga0466720_077535 3300042607 Bacteria 3302
132 Ga0466698_345682 3300042610 Archaea 1400
133 Ga0466696_041135 3300042596 Bacteria 1889
134 Ga0466729_220947 3300042621 Bacteria 5924
135 Ga0466731_188421 3300042622 Bacteria 30299
136 Ga0466735_159872 3300042624 Bacteria 3071
137 Ga0466702_010439 3300042635 Bacteria 9659
138 Ga0466708_020545 3300042652 Bacteria 23241
139 Ga0466708_125113 3300042652 Bacteria 3128
140 Ga0123357_10264342 3300009784 Bacteria 1812
141 Ga0123355_10029235 3300009826 Bacteria 8919
142 JGI24696J40584_12959537 3300002834 Bacteria 5259
143 Ga0068302_10107425 3300005071 Bacteria 5965
144 Ga0068305_10015077 3300005083 Unclassified 10769
145 Ga0466712_072984 3300042614 Bacteria 1825
146 Ga0466715_495495 3300042616 Bacteria 13941
147 Ga0466700_249991 3300042600 Bacteria 2225
148 Ga0466719_445201 3300042606 Bacteria 2687
149 Ga0466703_226689 3300042636 Bacteria 4119
150 Ga0466703_258700 3300042636 Bacteria 4466
151 Ga0466703_278911 3300042636 Bacteria 5110

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042610 Ga0466698_345682 Ga0466698_345682_109_1221 370
2 3300042602 Ga0466713_122637 Ga0466713_122637_61_1266 380
3 3300042599 Ga0466706_027362 Ga0466706_027362_2446_3609 381
4 3300042591 Ga0466692_022583 Ga0466692_022583_302_1528 397
5 3300042590 Ga0466690_132803 Ga0466690_132803_105_2183 406
6 3300042609 Ga0466722_057118 Ga0466722_057118_7408_8670 407
7 3300042616 Ga0466715_495495 Ga0466715_495495_12223_13557 414
8 3300042616 Ga0466715_210609 Ga0466715_210609_3791_5161 420
9 3300042621 Ga0466729_093264 Ga0466729_093264_4164_5546 424
10 3300042612 Ga0466705_196474 Ga0466705_196474_1232_2557 425
11 iso_pr_bacteria 2820336130 2820338927 425
12 3300042622 Ga0466731_188421 Ga0466731_188421_18930_20348 427
13 3300042604 Ga0466717_101443 Ga0466717_101443_7685_9019 429
14 3300009826 Ga0123355_10180479 Ga0123355_101804792 430
15 3300042606 Ga0466719_443311 Ga0466719_443311_486_1928 430
16 3300042636 Ga0466703_031525 Ga0466703_031525_13063_14520 430
17 3300010049 Ga0123356_10001915 Ga0123356_1000191517 431
18 3300038395 Ga0415639_004643 Ga0415639_004643_14611_15906 431
19 3300042614 Ga0466712_322848 Ga0466712_322848_201_1523 431
20 3300009826 Ga0123355_10008885 Ga0123355_100088852 432
21 3300024493 Ga0264413_105265 Ga0264413_1052654 433
22 3300042596 Ga0466696_208883 Ga0466696_208883_307_1728 433
23 3300042606 Ga0466719_445201 Ga0466719_445201_1014_2348 433
24 3300042615 Ga0466711_332692 Ga0466711_332692_1157_2620 433
25 3300042623 Ga0466734_073830 Ga0466734_073830_1120_2484 433
26 3300042615 Ga0466711_003505 Ga0466711_003505_327_1631 434
27 3300042636 Ga0466703_258700 Ga0466703_258700_1598_2932 434
28 3300042618 Ga0466723_163769 Ga0466723_163769_5818_7125 435
29 3300002834 JGI24696J40584_12946661 JGI24696J40584_129466612 436
30 3300042590 Ga0466690_281470 Ga0466690_281470_385_1743 436
31 3300042604 Ga0466717_117544 Ga0466717_117544_342_1691 436
32 3300042605 Ga0466716_459060 Ga0466716_459060_549_1907 436
33 3300042643 Ga0466704_337788 Ga0466704_337788_6689_8083 436
34 3300010167 Ga0123353_10002069 Ga0123353_100020693 437
35 3300010882 Ga0123354_10075272 Ga0123354_100752721 437
36 3300042593 Ga0466691_006210 Ga0466691_006210_4281_5594 437
37 3300042602 Ga0466713_109697 Ga0466713_109697_3422_4762 437
38 3300042606 Ga0466719_358926 Ga0466719_358926_15275_16588 437
39 3300042619 Ga0466726_136198 Ga0466726_136198_249_1562 437
40 iso_pr_bacteria 2820477775 2820479424 437
41 3300005083 Ga0068305_10015077 Ga0068305_100150779 438
42 3300009784 Ga0123357_10000434 Ga0123357_100004346 438
43 3300042608 Ga0466721_062284 Ga0466721_062284_42875_44236 438
44 3300042609 Ga0466722_124388 Ga0466722_124388_680_2056 438
45 3300042612 Ga0466705_095573 Ga0466705_095573_8762_10078 438
46 3300042649 Ga0466724_68643 Ga0466724_68643_12498_13814 438
47 3300042604 Ga0466717_150904 Ga0466717_150904_249_1688 439
48 3300002462 JGI24702J35022_10002609 JGI24702J35022_100026098 440
49 3300005083 Ga0068305_10037251 Ga0068305_100372518 440
50 3300042599 Ga0466706_283361 Ga0466706_283361_28_1368 440
51 3300042602 Ga0466713_149566 Ga0466713_149566_19303_20625 440
52 3300042605 Ga0466716_351938 Ga0466716_351938_600_1955 440
53 3300042613 Ga0466710_113359 Ga0466710_113359_563_1978 440
54 3300042615 Ga0466711_056060 Ga0466711_056060_400_1722 440
55 3300042635 Ga0466702_013605 Ga0466702_013605_755_2128 440
56 3300042656 Ga0466732_119516 Ga0466732_119516_150_1472 440
57 3300002462 JGI24702J35022_10006276 JGI24702J35022_100062766 441
58 3300010049 Ga0123356_10205046 Ga0123356_102050462 441
59 3300010167 Ga0123353_10167089 Ga0123353_101670892 441
60 3300042615 Ga0466711_342569 Ga0466711_342569_8432_9757 441
61 iso_pr_bacteria 2819999932 2820001333 441
62 3300042597 Ga0466699_110137 Ga0466699_110137_43_1371 442
63 3300042597 Ga0466699_161508 Ga0466699_161508_1807_3216 442
64 3300042606 Ga0466719_530064 Ga0466719_530064_2128_3513 442
65 3300042652 Ga0466708_356703 Ga0466708_356703_1310_2689 442
66 iso_pr_bacteria 2820444930 2820445011 442
67 3300002449 JGI24698J34947_10028842 JGI24698J34947_100288422 443
68 3300042592 Ga0466693_215130 Ga0466693_215130_195_1526 443
69 3300042596 Ga0466696_041135 Ga0466696_041135_187_1551 443
70 3300042607 Ga0466720_077535 Ga0466720_077535_794_2236 443
71 3300042614 Ga0466712_005899 Ga0466712_005899_10397_11761 443
72 3300042636 Ga0466703_226689 Ga0466703_226689_556_1932 443
73 3300002449 JGI24698J34947_10079811 JGI24698J34947_100798112 444
74 3300042605 Ga0466716_240462 Ga0466716_240462_138_1499 444
75 iso_pr_bacteria 2781125660 2781331830 444
76 iso_pu_archaea 2772191001 2773800179 444
77 3300002462 JGI24702J35022_10000668 JGI24702J35022_1000066817 445
78 3300042621 Ga0466729_144255 Ga0466729_144255_107_1495 445
79 3300005071 Ga0068302_10107425 Ga0068302_101074253 446
80 3300010049 Ga0123356_10103855 Ga0123356_101038552 446
81 3300010167 Ga0123353_10039063 Ga0123353_100390636 446
82 3300042620 Ga0466728_440214 Ga0466728_440214_279_1652 446
83 3300042636 Ga0466703_243961 Ga0466703_243961_6926_8311 446
84 3300010882 Ga0123354_10285644 Ga0123354_102856442 447
85 3300042601 Ga0466707_031179 Ga0466707_031179_6671_8014 447
86 3300042605 Ga0466716_487231 Ga0466716_487231_330_1673 447
87 3300042610 Ga0466698_275499 Ga0466698_275499_331_1719 447
88 3300042624 Ga0466735_159872 Ga0466735_159872_1471_2814 447
89 3300042643 Ga0466704_506007 Ga0466704_506007_88_1503 447
90 3300002462 JGI24702J35022_10066690 JGI24702J35022_100666902 448
91 3300010167 Ga0123353_10405740 Ga0123353_104057402 448
92 3300042612 Ga0466705_070299 Ga0466705_070299_2144_3634 448
93 3300042616 Ga0466715_437218 Ga0466715_437218_449_2059 448
94 3300042620 Ga0466728_403123 Ga0466728_403123_46_1479 448
95 3300042643 Ga0466704_593648 Ga0466704_593648_11471_12877 448
96 3300002462 JGI24702J35022_10032324 JGI24702J35022_100323243 449
97 3300002834 JGI24696J40584_12959537 JGI24696J40584_129595373 449
98 3300010049 Ga0123356_10238191 Ga0123356_102381912 449
99 3300010167 Ga0123353_10020725 Ga0123353_100207256 449
100 3300042593 Ga0466691_108695 Ga0466691_108695_267_1616 449
101 3300042607 Ga0466720_141207 Ga0466720_141207_1406_2848 449
102 3300042612 Ga0466705_468840 Ga0466705_468840_750_2099 449
103 3300042659 Ga0466733_026128 Ga0466733_026128_17246_18616 449
104 3300002504 JGI24705J35276_12230721 JGI24705J35276_122307215 450
105 3300042593 Ga0466691_008920 Ga0466691_008920_4361_5992 450
106 3300042621 Ga0466729_068906 Ga0466729_068906_77_1465 450
107 3300042605 Ga0466716_035366 Ga0466716_035366_777_2132 451
108 3300042614 Ga0466712_056882 Ga0466712_056882_1834_3189 451
109 3300042617 Ga0466718_027078 Ga0466718_027078_461_1816 451
110 3300042652 Ga0466708_020545 Ga0466708_020545_8161_9549 451
111 3300010049 Ga0123356_10280653 Ga0123356_102806532 452
112 3300042616 Ga0466715_291678 Ga0466715_291678_332_1843 452
113 3300042648 Ga0466709_204549 Ga0466709_204549_1533_2963 452
114 3300042600 Ga0466700_249991 Ga0466700_249991_89_1450 453
115 3300010167 Ga0123353_10382787 Ga0123353_103827871 454
116 3300042600 Ga0466700_475226 Ga0466700_475226_86_1450 454
117 3300042617 Ga0466718_024929 Ga0466718_024929_11068_12459 454
118 3300042617 Ga0466718_116825 Ga0466718_116825_2007_3398 454
119 3300042620 Ga0466728_233009 Ga0466728_233009_941_2356 454
120 3300042643 Ga0466704_142201 Ga0466704_142201_4751_6178 454
121 3300042656 Ga0466732_283510 Ga0466732_283510_117_1526 454
122 3300000089 AustNasuHG_c1014715 AustNasuHG_10147153 455
123 3300042652 Ga0466708_125113 Ga0466708_125113_1314_2681 455
124 iso_pr_bacteria 2820570671 2820572017 455
125 3300010049 Ga0123356_10000035 Ga0123356_10000035121 456
126 iso_pr_bacteria 2820744581 2820744705 456
127 3300009784 Ga0123357_10264342 Ga0123357_102643422 457
128 3300042612 Ga0466705_246365 Ga0466705_246365_417_1859 457
129 3300042614 Ga0466712_072984 Ga0466712_072984_297_1700 457
130 3300042612 Ga0466705_381672 Ga0466705_381672_6841_8280 458
131 3300042635 Ga0466702_010439 Ga0466702_010439_5260_6696 458
132 3300042607 Ga0466720_094584 Ga0466720_094584_525_1964 459
133 3300042643 Ga0466704_117779 Ga0466704_117779_897_2276 459
134 3300005071 Ga0068302_10030014 Ga0068302_100300142 460
135 3300042592 Ga0466693_063589 Ga0466693_063589_336_1718 460
136 3300042643 Ga0466704_098808 Ga0466704_098808_2947_4329 460
137 3300042597 Ga0466699_052049 Ga0466699_052049_213_1664 461
138 3300042596 Ga0466696_192278 Ga0466696_192278_1389_2777 462
139 3300042652 Ga0466708_308722 Ga0466708_308722_15768_17156 462
140 3300042612 Ga0466705_309828 Ga0466705_309828_70_1461 463
141 3300042635 Ga0466702_009442 Ga0466702_009442_1892_3286 464
142 3300009826 Ga0123355_10029235 Ga0123355_100292359 465
143 3300042612 Ga0466705_488191 Ga0466705_488191_4756_6180 465
144 iso_pr_bacteria 2820724199 2820724231 465
145 3300042602 Ga0466713_128590 Ga0466713_128590_432_1835 467
146 3300042607 Ga0466720_011473 Ga0466720_011473_299_1714 471
147 3300042615 Ga0466711_063034 Ga0466711_063034_142_1560 472
148 3300042591 Ga0466692_165073 Ga0466692_165073_142468_143889 473
149 3300042636 Ga0466703_278911 Ga0466703_278911_589_2016 475
150 3300042635 Ga0466702_410205 Ga0466702_410205_1198_2694 476
151 iso_pr_bacteria 2820765201 2820766811 476
152 3300042617 Ga0466718_020982 Ga0466718_020982_999_2465 478
153 3300042636 Ga0466703_020846 Ga0466703_020846_1015_2460 481
154 iso_pr_bacteria 2778260938 2778350141 481
155 3300042652 Ga0466708_047886 Ga0466708_047886_6728_8239 483
156 3300042600 Ga0466700_233862 Ga0466700_233862_8317_9801 486
157 3300042621 Ga0466729_220947 Ga0466729_220947_186_1649 487
158 3300009826 Ga0123355_10068038 Ga0123355_100680383 489
159 3300042596 Ga0466696_138496 Ga0466696_138496_236_1747 490
160 3300042616 Ga0466715_124576 Ga0466715_124576_660_2183 492
161 iso_pr_bacteria 2820277137 2820278962 493
162 iso_pr_bacteria 2820294436 2820295112 513
163 3300042597 Ga0466699_293486 Ga0466699_293486_2665_4347 517
164 3300042614 Ga0466712_287903 Ga0466712_287903_533_2140 524
165 iso_pr_bacteria 2820724199 2820724884 566
166 iso_pr_bacteria 2820724199 2820724582 575
167 iso_pr_bacteria 2778260935 2778342968 604

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01047 MarR MarR family 394 441 0.98
PF13412 HTH_24 Winged helix-turn-helix DNA-binding 465 510 0.96
PF13749 HATPase_c_4 Putative ATP-dependent DNA helicase recG C-terminal 282 368 0.95
PF08279 HTH_11 HTH domain 396 449 0.91
PF12802 MarR_2 MarR family 469 514 0.91
PF04326 SLFN_AlbA_2 Schlafen, AlbA_2 9 114 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.61 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.