Protein Family IF07408
Metagenome
Isolate
184
Members
47
Samples
177
Scaffolds
160.57
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_221213|Ga0466712_221213_4639_5208
- Length
- 189 aa
- Sequence
- LRAARYSLRDEIWDYVNAHKYYMEVAMMKVGLGQDMHRLVKGRRFLLGGVELPAKRGELGHSDGDVLAHAACDAILGAAALGDIGSLFPPSDPVWKDADSMGLLRGGFSLVKEAGWRLVSLDCVVSCEAPKVLPFRDAIRQSLAEALEVSVDSVFVKGKTAEGLGPVGKGRAVQATAVCLLEKGLGMPE
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.2%
Kalotermitidae
31.8%
Unclassified
15.9%
Rhinotermitidae
4.5%
Aphididae
2.3%
Termopsidae
2.3%
Taxonomy
Archaea
0
Bacteria
177
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 12 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 13 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 14 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 22 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_021924 | 3300038395 | Bacteria | 1729 |
| 2 | Ga0466694_018344 | 3300042594 | Bacteria | 3174 |
| 3 | Ga0466696_342229 | 3300042596 | Bacteria | 1213 |
| 4 | Ga0466699_130586 | 3300042597 | Bacteria | 14073 |
| 5 | Ga0466699_165596 | 3300042597 | Bacteria | 6934 |
| 6 | Ga0466699_232212 | 3300042597 | Bacteria | 1062 |
| 7 | Ga0466699_273572 | 3300042597 | Bacteria | 1205 |
| 8 | Ga0466707_276638 | 3300042601 | Bacteria | 2380 |
| 9 | Ga0466720_010019 | 3300042607 | Bacteria | 9693 |
| 10 | Ga0466720_033612 | 3300042607 | Bacteria | 11375 |
| 11 | Ga0466720_065204 | 3300042607 | Bacteria | 12621 |
| 12 | Ga0123353_10420243 | 3300010167 | Bacteria | 1981 |
| 13 | Ga0466712_123549 | 3300042614 | Bacteria | 2863 |
| 14 | Ga0466711_354091 | 3300042615 | Bacteria | 27845 |
| 15 | Ga0466715_639408 | 3300042616 | Bacteria | 24668 |
| 16 | Ga0466718_165652 | 3300042617 | Bacteria | 2117 |
| 17 | Ga0466728_330333 | 3300042620 | Bacteria | 6651 |
| 18 | Ga0466704_301798 | 3300042643 | Bacteria | 12755 |
| 19 | Ga0466708_126888 | 3300042652 | Bacteria | 2965 |
| 20 | Ga0466708_166153 | 3300042652 | Bacteria | 7276 |
| 21 | JGI24698J34947_10083923 | 3300002449 | Unclassified | 1485 |
| 22 | JGI24698J34947_10128790 | 3300002449 | Bacteria | 1085 |
| 23 | JGI24698J34947_10141016 | 3300002449 | Unclassified | 1015 |
| 24 | Ga0072941_1059168 | 3300005201 | Bacteria | 951 |
| 25 | Ga0466732_001279 | 3300042656 | Bacteria | 19230 |
| 26 | Ga0466690_176715 | 3300042590 | Bacteria | 12086 |
| 27 | Ga0466699_105628 | 3300042597 | Bacteria | 2183 |
| 28 | Ga0466720_038760 | 3300042607 | Bacteria | 7675 |
| 29 | Ga0466720_085719 | 3300042607 | Bacteria | 2008 |
| 30 | Ga0466720_092177 | 3300042607 | Bacteria | 42147 |
| 31 | Ga0466698_446550 | 3300042610 | Bacteria | 1809 |
| 32 | Ga0123353_10128452 | 3300010167 | Bacteria | 4070 |
| 33 | Ga0123353_10411812 | 3300010167 | Bacteria | 2007 |
| 34 | Ga0466712_309211 | 3300042614 | Bacteria | 3467 |
| 35 | Ga0466708_346914 | 3300042652 | Bacteria | 2546 |
| 36 | JGI24698J34947_10039319 | 3300002449 | Bacteria | 2449 |
| 37 | JGI24698J34947_10042650 | 3300002449 | Bacteria | 2329 |
| 38 | JGI24698J34947_10046097 | 3300002449 | Bacteria | 2220 |
| 39 | JGI24698J34947_10142505 | 3300002449 | Bacteria | 1007 |
| 40 | JGI24698J34947_10165145 | 3300002449 | Bacteria | 902 |
| 41 | JGI24695J34938_10013664 | 3300002450 | Bacteria | 4253 |
| 42 | JGI24695J34938_10015152 | 3300002450 | Bacteria | 3965 |
| 43 | Ga0074263_105222 | 3300005485 | Bacteria | 1507 |
| 44 | Ga0466732_132877 | 3300042656 | Bacteria | 27559 |
| 45 | Ga0466690_320519 | 3300042590 | Bacteria | 3313 |
| 46 | Ga0466693_018150 | 3300042592 | Bacteria | 1870 |
| 47 | Ga0466691_049691 | 3300042593 | Bacteria | 5789 |
| 48 | Ga0466699_014337 | 3300042597 | Bacteria | 3540 |
| 49 | Ga0466699_043599 | 3300042597 | Bacteria | 14823 |
| 50 | Ga0466699_079701 | 3300042597 | Bacteria | 27712 |
| 51 | Ga0466699_240886 | 3300042597 | Bacteria | 1262 |
| 52 | Ga0466700_047853 | 3300042600 | Bacteria | 1496 |
| 53 | Ga0466719_098236 | 3300042606 | Bacteria | 3411 |
| 54 | Ga0466720_093975 | 3300042607 | Bacteria | 24415 |
| 55 | Ga0123356_10094119 | 3300010049 | Bacteria | 2860 |
| 56 | Ga0123356_11383214 | 3300010049 | Bacteria | 865 |
| 57 | Ga0123353_10018725 | 3300010167 | Bacteria | 10253 |
| 58 | Ga0466712_186083 | 3300042614 | Bacteria | 1144 |
| 59 | Ga0466712_253646 | 3300042614 | Bacteria | 3074 |
| 60 | Ga0466715_347412 | 3300042616 | Bacteria | 1462 |
| 61 | Ga0466723_248024 | 3300042618 | Bacteria | 12552 |
| 62 | Ga0466705_241780 | 3300042612 | Bacteria | 1689 |
| 63 | Ga0466709_385456 | 3300042648 | Bacteria | 4229 |
| 64 | JGI24698J34947_10016506 | 3300002449 | Bacteria | 4008 |
| 65 | JGI24698J34947_10033602 | 3300002449 | Bacteria | 2690 |
| 66 | Ga0264413_105391 | 3300024493 | Bacteria | 18355 |
| 67 | Ga0264413_114167 | 3300024493 | Bacteria | 1260 |
| 68 | Ga0466690_068437 | 3300042590 | Bacteria | 3194 |
| 69 | Ga0466699_015066 | 3300042597 | Bacteria | 10994 |
| 70 | Ga0466699_121031 | 3300042597 | Bacteria | 18413 |
| 71 | Ga0466699_140995 | 3300042597 | Bacteria | 1755 |
| 72 | Ga0466699_175529 | 3300042597 | Bacteria | 1262 |
| 73 | Ga0466699_316756 | 3300042597 | Bacteria | 1379 |
| 74 | Ga0466700_346639 | 3300042600 | Bacteria | 1412 |
| 75 | Ga0466720_070852 | 3300042607 | Bacteria | 2191 |
| 76 | Ga0466720_191139 | 3300042607 | Bacteria | 1770 |
| 77 | Ga0466721_365949 | 3300042608 | Bacteria | 2023 |
| 78 | Ga0123355_10181810 | 3300009826 | Bacteria | 3119 |
| 79 | Ga0123353_11398764 | 3300010167 | Bacteria | 900 |
| 80 | Ga0466712_305926 | 3300042614 | Bacteria | 1429 |
| 81 | Ga0466715_403907 | 3300042616 | Bacteria | 7671 |
| 82 | Ga0466718_124631 | 3300042617 | Bacteria | 1710 |
| 83 | Ga0466723_046544 | 3300042618 | Unclassified | 2523 |
| 84 | Ga0466705_351977 | 3300042612 | Bacteria | 6036 |
| 85 | Ga0466703_387645 | 3300042636 | Bacteria | 10534 |
| 86 | Ga0466704_308552 | 3300042643 | Bacteria | 41896 |
| 87 | Ga0466708_147695 | 3300042652 | Bacteria | 7432 |
| 88 | Ga0466708_376870 | 3300042652 | Bacteria | 11529 |
| 89 | JGI24698J34947_10018639 | 3300002449 | Bacteria | 3748 |
| 90 | JGI24698J34947_10052692 | 3300002449 | Bacteria | 2041 |
| 91 | JGI24698J34947_10091457 | 3300002449 | Bacteria | 1395 |
| 92 | JGI24695J34938_10014503 | 3300002450 | Bacteria | 4082 |
| 93 | Ga0072941_1042783 | 3300005201 | Bacteria | 14296 |
| 94 | Ga0466727_350715 | 3300042655 | Bacteria | 4593 |
| 95 | Ga0466696_024441 | 3300042596 | Bacteria | 1585 |
| 96 | Ga0466719_203266 | 3300042606 | Bacteria | 10396 |
| 97 | Ga0466720_068610 | 3300042607 | Bacteria | 4157 |
| 98 | Ga0466722_094047 | 3300042609 | Bacteria | 2141 |
| 99 | Ga0466698_215403 | 3300042610 | Bacteria | 1060 |
| 100 | Ga0123353_11389066 | 3300010167 | Bacteria | 904 |
| 101 | Ga0466712_007053 | 3300042614 | Bacteria | 4420 |
| 102 | Ga0466715_291356 | 3300042616 | Bacteria | 1257 |
| 103 | Ga0466715_330300 | 3300042616 | Bacteria | 1109 |
| 104 | Ga0466718_112096 | 3300042617 | Bacteria | 4854 |
| 105 | Ga0466723_219112 | 3300042618 | Bacteria | 10760 |
| 106 | Ga0466702_023993 | 3300042635 | Bacteria | 4366 |
| 107 | Ga0466708_152385 | 3300042652 | Bacteria | 8243 |
| 108 | JGI24698J34947_10099815 | 3300002449 | Bacteria | 1308 |
| 109 | JGI24698J34947_10125721 | 3300002449 | Bacteria | 1105 |
| 110 | Ga0072941_1017044 | 3300005201 | Bacteria | 6781 |
| 111 | Ga0072941_1018465 | 3300005201 | Bacteria | 27703 |
| 112 | Ga0072941_1184353 | 3300005201 | Bacteria | 1412 |
| 113 | Ga0466690_298142 | 3300042590 | Bacteria | 2192 |
| 114 | Ga0466692_148648 | 3300042591 | Unclassified | 2723 |
| 115 | Ga0466696_034279 | 3300042596 | Bacteria | 28917 |
| 116 | Ga0466699_046050 | 3300042597 | Bacteria | 4163 |
| 117 | Ga0466699_054554 | 3300042597 | Bacteria | 1105 |
| 118 | Ga0466699_213851 | 3300042597 | Bacteria | 1420 |
| 119 | Ga0466720_028981 | 3300042607 | Bacteria | 3173 |
| 120 | Ga0466720_089237 | 3300042607 | Bacteria | 12458 |
| 121 | Ga0466722_080885 | 3300042609 | Bacteria | 53116 |
| 122 | Ga0123355_10556776 | 3300009826 | Bacteria | 1383 |
| 123 | Ga0123356_12700856 | 3300010049 | Bacteria | 622 |
| 124 | Ga0466712_004388 | 3300042614 | Bacteria | 4159 |
| 125 | Ga0466712_221213 | 3300042614 | Bacteria | 6373 |
| 126 | Ga0466715_001764 | 3300042616 | Bacteria | 6976 |
| 127 | Ga0466715_100584 | 3300042616 | Bacteria | 1187 |
| 128 | Ga0466715_157142 | 3300042616 | Bacteria | 16221 |
| 129 | Ga0466718_090573 | 3300042617 | Bacteria | 30309 |
| 130 | Ga0466728_074826 | 3300042620 | Bacteria | 5121 |
| 131 | Ga0466728_256307 | 3300042620 | Bacteria | 7861 |
| 132 | Ga0466705_338630 | 3300042612 | Bacteria | 14293 |
| 133 | Ga0466703_405328 | 3300042636 | Bacteria | 1179 |
| 134 | Ga0466703_427065 | 3300042636 | Bacteria | 7370 |
| 135 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 136 | JGI24698J34947_10033339 | 3300002449 | Bacteria | 2703 |
| 137 | JGI24698J34947_10075457 | 3300002449 | Bacteria | 1603 |
| 138 | JGI24698J34947_10134953 | 3300002449 | Bacteria | 1049 |
| 139 | JGI24695J34938_10061010 | 3300002450 | Bacteria | 1607 |
| 140 | Ga0127648_100010 | 3300009534 | Bacteria | 473475 |
| 141 | Ga0466690_315591 | 3300042590 | Bacteria | 3464 |
| 142 | Ga0466694_049703 | 3300042594 | Bacteria | 19100 |
| 143 | Ga0466700_493121 | 3300042600 | Bacteria | 2865 |
| 144 | Ga0466716_048006 | 3300042605 | Unclassified | 4061 |
| 145 | Ga0466719_468213 | 3300042606 | Bacteria | 2215 |
| 146 | Ga0466720_022416 | 3300042607 | Bacteria | 3126 |
| 147 | Ga0466698_151348 | 3300042610 | Bacteria | 2552 |
| 148 | Ga0466698_177358 | 3300042610 | Bacteria | 2323 |
| 149 | Ga0123356_10683547 | 3300010049 | Bacteria | 1195 |
| 150 | Ga0466712_202335 | 3300042614 | Bacteria | 2422 |
| 151 | Ga0466705_189089 | 3300042612 | Bacteria | 20276 |
| 152 | JGI24698J34947_10046910 | 3300002449 | Bacteria | 2196 |
| 153 | JGI24698J34947_10086195 | 3300002449 | Bacteria | 1456 |
| 154 | JGI24698J34947_10120044 | 3300002449 | Unclassified | 1142 |
| 155 | JGI24695J34938_10010789 | 3300002450 | Bacteria | 4969 |
| 156 | JGI24699J35502_11128741 | 3300002509 | Unclassified | 4491 |
| 157 | Ga0072941_1155158 | 3300005201 | Bacteria | 1213 |
| 158 | Ga0466732_138248 | 3300042656 | Bacteria | 3027 |
| 159 | Ga0264413_106474 | 3300024493 | Bacteria | 4949 |
| 160 | Ga0466699_040211 | 3300042597 | Bacteria | 18490 |
| 161 | Ga0466699_054014 | 3300042597 | Bacteria | 2260 |
| 162 | Ga0466699_115248 | 3300042597 | Bacteria | 1601 |
| 163 | Ga0466699_261965 | 3300042597 | Bacteria | 1449 |
| 164 | Ga0466700_294620 | 3300042600 | Bacteria | 2649 |
| 165 | Ga0466720_179613 | 3300042607 | Bacteria | 1067 |
| 166 | Ga0466720_218533 | 3300042607 | Bacteria | 7675 |
| 167 | Ga0466712_080478 | 3300042614 | Bacteria | 2188 |
| 168 | Ga0466712_144801 | 3300042614 | Bacteria | 6935 |
| 169 | Ga0466712_320459 | 3300042614 | Bacteria | 1038 |
| 170 | Ga0466728_245889 | 3300042620 | Bacteria | 19857 |
| 171 | Ga0466705_222667 | 3300042612 | Bacteria | 2422 |
| 172 | Ga0466708_272567 | 3300042652 | Bacteria | 3485 |
| 173 | Ga0466708_346744 | 3300042652 | Bacteria | 6240 |
| 174 | Ga0466727_325245 | 3300042655 | Bacteria | 2903 |
| 175 | JGI24698J34947_10098998 | 3300002449 | Bacteria | 1316 |
| 176 | JGI24695J34938_10193742 | 3300002450 | Bacteria | 845 |
| 177 | Ga0072941_1056889 | 3300005201 | Bacteria | 3122 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02542 | YgbB | YgbB family | 28 | 181 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.