Protein Family IF07390

Metagenome Isolate
122 Members
34 Samples
115 Scaffolds
231.19 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_159333|Ga0466712_159333_244_1035
Length
263 aa
Sequence
MREGFSQSGALGKIRQYPRKPAYKKTGSIFKMITSSQSSFKYLDIVASFFVAVLVVSNIASSAKIVDLGISLFSVRLAFDGGTLLFPLAYVLGDVLTEVYGFKTARRVIWTGFAVMALTTAVFFTLGVLPPEAGWEAETGTAAYNAVLGGMSYGGIVLASLTAYLAGEFSNAAVLSKLKVKMKGRLLFVRTIGSTLVGELIDMVFCVLRASAAGVFGWELFWPLVLTNYILKCGIEALMTPFTYWASRFFFCLEGVDVYDKTA

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 65.6%
Unclassified 28.1%
Rhinotermitidae 3.1%
Termopsidae 3.1%

🌳 Taxonomy

Archaea 1
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
2 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
8 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
9 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
15 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
16 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
17 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
18 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
19 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
23 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
24 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
25 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
26 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_085499 3300042656 Bacteria 5569
2 Ga0123356_10068297 3300010049 Bacteria 3329
3 Ga0123356_11069000 3300010049 Bacteria 976
4 Ga0123356_11344547 3300010049 Bacteria 876
5 JGI24698J34947_10050674 3300002449 Bacteria 2092
6 JGI24698J34947_10099657 3300002449 Bacteria 1310
7 JGI24695J34938_10002132 3300002450 Bacteria 15455
8 JGI24695J34938_10002406 3300002450 Bacteria 14373
9 JGI24695J34938_10003838 3300002450 Bacteria 10201
10 Ga0072941_1017609 3300005201 Bacteria 9351
11 Ga0072941_1025575 3300005201 Bacteria 46927
12 Ga0074263_101800 3300005485 Bacteria 1386
13 Ga0074263_103077 3300005485 Unclassified 4692
14 Ga0466720_001927 3300042607 Unclassified 2260
15 Ga0466720_105574 3300042607 Bacteria 1824
16 Ga0466732_418537 3300042656 Bacteria 3160
17 Ga0415639_007067 3300038395 Bacteria 6330
18 Ga0466694_069852 3300042594 Bacteria 47276
19 Ga0466694_074253 3300042594 Bacteria 1453
20 Ga0466731_017063 3300042622 Bacteria 4750
21 Ga0466702_385326 3300042635 Bacteria 9577
22 Ga0123353_10896522 3300010167 Bacteria 1208
23 JGI24698J34947_10028780 3300002449 Bacteria 2940
24 JGI24698J34947_10089811 3300002449 Bacteria 1413
25 JGI24695J34938_10001053 3300002450 Bacteria 25032
26 JGI24695J34938_10024902 3300002450 Bacteria 2869
27 JGI24699J35502_11123234 3300002509 Unclassified 3520
28 Ga0072941_1022013 3300005201 Bacteria 7336
29 Ga0466698_416931 3300042610 Bacteria 1113
30 Ga0466712_284269 3300042614 Bacteria 3333
31 Ga0466712_323889 3300042614 Unclassified 1933
32 Ga0466729_031789 3300042621 Bacteria 6129
33 Ga0264413_120978 3300024493 Bacteria 2513
34 Ga0466694_129521 3300042594 Bacteria 2294
35 Ga0466735_071932 3300042624 Bacteria 1545
36 Ga0466702_297323 3300042635 Bacteria 1640
37 Ga0123356_10004861 3300010049 Bacteria 13811
38 Ga0123356_10232301 3300010049 Bacteria 1909
39 Ga0123356_10580671 3300010049 Bacteria 1284
40 JGI24698J34947_10031451 3300002449 Bacteria 2793
41 Ga0466700_406208 3300042600 Bacteria 1628
42 Ga0466712_016879 3300042614 Bacteria 6335
43 Ga0466718_002687 3300042617 Unclassified 4739
44 Ga0466718_107952 3300042617 Bacteria 2572
45 Ga0466694_050111 3300042594 Bacteria 44560
46 Ga0466694_145513 3300042594 Bacteria 23769
47 Ga0466694_155389 3300042594 Bacteria 1153
48 Ga0123353_11365539 3300010167 Unclassified 914
49 JGI24698J34947_10030302 3300002449 Unclassified 2854
50 JGI24698J34947_10036555 3300002449 Bacteria 2556
51 JGI24695J34938_10000396 3300002450 Bacteria 42777
52 Ga0072940_1066150 3300005200 Bacteria 981
53 Ga0072941_1025576 3300005201 Bacteria 5222
54 Ga0466712_048509 3300042614 Unclassified 1616
55 Ga0466718_100022 3300042617 Bacteria 4479
56 Ga0466718_108270 3300042617 Bacteria 5444
57 Ga0466732_094890 3300042656 Bacteria 4967
58 Ga0466693_187683 3300042592 Bacteria 64758
59 Ga0466693_332400 3300042592 Bacteria 40906
60 Ga0466695_316094 3300042595 Bacteria 79149
61 Ga0466731_092634 3300042622 Bacteria 1486
62 Ga0123356_10001283 3300010049 Bacteria 27830
63 Ga0123356_11554948 3300010049 Unclassified 817
64 Ga0123353_10804594 3300010167 Unclassified 1297
65 JGI24698J34947_10019707 3300002449 Bacteria 3635
66 JGI24698J34947_10052189 3300002449 Unclassified 2053
67 JGI24698J34947_10067684 3300002449 Unclassified 1731
68 Ga0072940_1030575 3300005200 Bacteria 1523
69 Ga0466713_012868 3300042602 Bacteria 15457
70 Ga0466713_022295 3300042602 Bacteria 22019
71 Ga0466712_118323 3300042614 Bacteria 21090
72 Ga0466712_159333 3300042614 Bacteria 1260
73 Ga0466694_029179 3300042594 Bacteria 24696
74 Ga0123355_11073292 3300009826 Bacteria 842
75 Ga0123356_10300944 3300010049 Bacteria 1709
76 AustNasuHG_c1004499 3300000089 Bacteria 4999
77 JGI24698J34947_10030618 3300002449 Bacteria 2837
78 JGI24698J34947_10038982 3300002449 Unclassified 2462
79 JGI24695J34938_10136865 3300002450 Bacteria 1000
80 Ga0466720_049787 3300042607 Unclassified 2335
81 Ga0466720_062177 3300042607 Bacteria 4000
82 Ga0466720_116644 3300042607 Bacteria 39029
83 Ga0466720_164322 3300042607 Bacteria 18462
84 Ga0466712_004252 3300042614 Bacteria 8473
85 Ga0466712_141898 3300042614 Bacteria 2597
86 Ga0466718_021868 3300042617 Bacteria 45512
87 Ga0466718_073616 3300042617 Bacteria 4990
88 Ga0123356_10000245 3300010049 Bacteria 62546
89 Ga0123356_10009702 3300010049 Bacteria 9494
90 Ga0123356_10377091 3300010049 Bacteria 1550
91 Ga0123353_10284346 3300010167 Bacteria 2537
92 Ga0123353_10481990 3300010167 Archaea 1815
93 JGI24698J34947_10017966 3300002449 Unclassified 3828
94 JGI24698J34947_10041232 3300002449 Bacteria 2379
95 JGI24698J34947_10073037 3300002449 Bacteria 1639
96 Ga0072941_1003904 3300005201 Bacteria 42341
97 Ga0072941_1027575 3300005201 Bacteria 2118
98 Ga0074263_100434 3300005485 Bacteria 2078
99 Ga0466713_048014 3300042602 Bacteria 98008
100 Ga0466720_093280 3300042607 Bacteria 12518
101 Ga0466720_133655 3300042607 Bacteria 1486
102 Ga0466698_211289 3300042610 Bacteria 7406
103 Ga0466712_148517 3300042614 Bacteria 9065
104 Ga0466712_170223 3300042614 Bacteria 6612
105 Ga0466718_057904 3300042617 Bacteria 3620
106 Ga0466732_124143 3300042656 Bacteria 1774
107 Ga0466702_367210 3300042635 Bacteria 1208
108 JGI24698J34947_10000584 3300002449 Bacteria 17376
109 JGI24698J34947_10041828 3300002449 Bacteria 2358
110 JGI24698J34947_10096921 3300002449 Bacteria 1337
111 JGI24695J34938_10000370 3300002450 Bacteria 44494
112 JGI24695J34938_10007007 3300002450 Bacteria 6681
113 Ga0466707_250347 3300042601 Bacteria 2617
114 Ga0466720_065433 3300042607 Bacteria 5730
115 Ga0466720_076694 3300042607 Bacteria 3738

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02592 Vut_1 Putative vitamin uptake transporter 80 246 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02592 GO:1990397 queuosine salvage BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.