Protein Family IF07374
Metagenome
Isolate
145
Members
56
Samples
120
Scaffolds
268.37
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_116043|Ga0466712_116043_7771_8712
- Length
- 313 aa
- Sequence
- MRYVHRPQRGIGGGVDRAIRERGLVVESAVQCDKRNLVGSFVKVLKHKLDVCRAVAFITYKEWGAYRTHSMVSIFVGPVYFIVQYFIWTAVYSGGDTLNGIEYSQMIRYFGVTVLIGYLTMDFADWNLSMLIRTGKFLTFALRPLNHRFFAFSQKIGHRTLGFIVEFIPCILIFIFLFKVDMRSANLPWTLLSIALAFFMNFFVNYCLGMASFWIVQSEGIRSVYSLLGGVFSGMLIPLVFFPKPLQTLQFFLPFQYTSYVPAMVFLGSYSLGDVHLSIPAIVAVQAAVVLIAFIVSEILYKAAMRQFTAVGA
Sample Types
Isolate
17.2%
Metagenome
82.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Unclassified
35.2%
Blattidae
7.4%
Scarabaeidae
3.7%
Hodotermitidae
1.9%
Kalotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 7 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 8 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 9 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 10 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 22 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 23 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 24 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 25 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 26 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 29 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 37 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 38 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 39 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 44 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 45 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 46 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 47 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 48 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 49 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 51 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 52 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 53 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 54 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 55 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_062693 | 3300042599 | Bacteria | 62593 |
| 2 | Ga0466717_072992 | 3300042604 | Bacteria | 2182 |
| 3 | Ga0123356_10028377 | 3300010049 | Bacteria | 5243 |
| 4 | Ga0123353_10846379 | 3300010167 | Bacteria | 1254 |
| 5 | AustNasuHG_c1012435 | 3300000089 | Bacteria | 2938 |
| 6 | JGI24698J34947_10078219 | 3300002449 | Unclassified | 1561 |
| 7 | JGI24695J34938_10000637 | 3300002450 | Bacteria | 33482 |
| 8 | JGI24695J34938_10003807 | 3300002450 | Bacteria | 10261 |
| 9 | Ga0466734_157093 | 3300042623 | Bacteria | 1463 |
| 10 | Ga0466702_263059 | 3300042635 | Bacteria | 1218 |
| 11 | Ga0123356_10272798 | 3300010049 | Bacteria | 1782 |
| 12 | JGI24695J34938_10025737 | 3300002450 | Bacteria | 2807 |
| 13 | Ga0466702_380134 | 3300042635 | Bacteria | 1398 |
| 14 | Ga0415639_087458 | 3300038395 | Bacteria | 1841 |
| 15 | Ga0466693_360222 | 3300042592 | Unclassified | 2538 |
| 16 | Ga0466712_037449 | 3300042614 | Bacteria | 1901 |
| 17 | Ga0466706_028263 | 3300042599 | Bacteria | 13075 |
| 18 | Ga0466706_046031 | 3300042599 | Unclassified | 1637 |
| 19 | Ga0466706_153272 | 3300042599 | Bacteria | 2825 |
| 20 | Ga0466706_168425 | 3300042599 | Bacteria | 7982 |
| 21 | Ga0466706_245273 | 3300042599 | Unclassified | 7361 |
| 22 | Ga0466720_189904 | 3300042607 | Bacteria | 19102 |
| 23 | Ga0466698_084003 | 3300042610 | Bacteria | 1683 |
| 24 | Ga0466698_203230 | 3300042610 | Bacteria | 1246 |
| 25 | Ga0123355_10201843 | 3300009826 | Bacteria | 2902 |
| 26 | Ga0123356_10001228 | 3300010049 | Bacteria | 28467 |
| 27 | Ga0123353_10145530 | 3300010167 | Bacteria | 3789 |
| 28 | 2230954224 | 2228664003 | Bacteria | 9895 |
| 29 | AustNasuHG_c1001074 | 3300000089 | Bacteria | 9823 |
| 30 | JGI24698J34947_10005198 | 3300002449 | Bacteria | 7139 |
| 31 | JGI24698J34947_10117581 | 3300002449 | Unclassified | 1161 |
| 32 | JGI24695J34938_10000575 | 3300002450 | Bacteria | 35379 |
| 33 | JGI24695J34938_10001872 | 3300002450 | Bacteria | 17094 |
| 34 | JGI24703J35330_11747871 | 3300002501 | Bacteria | 8748 |
| 35 | JGI24703J35330_11748572 | 3300002501 | Bacteria | 20517 |
| 36 | JGI24697J35500_11259319 | 3300002507 | Bacteria | 2910 |
| 37 | Ga0072941_1031749 | 3300005201 | Bacteria | 2691 |
| 38 | Ga0072941_1067121 | 3300005201 | Bacteria | 5812 |
| 39 | Ga0466731_349246 | 3300042622 | Bacteria | 4355 |
| 40 | Ga0415639_016490 | 3300038395 | Bacteria | 11177 |
| 41 | Ga0466694_339879 | 3300042594 | Bacteria | 2942 |
| 42 | Ga0466699_102664 | 3300042597 | Bacteria | 3339 |
| 43 | Ga0466732_355958 | 3300042656 | Bacteria | 12046 |
| 44 | Ga0466705_498151 | 3300042612 | Bacteria | 7131 |
| 45 | Ga0466712_013867 | 3300042614 | Unclassified | 1423 |
| 46 | Ga0466718_114808 | 3300042617 | Bacteria | 2446 |
| 47 | Ga0466706_014531 | 3300042599 | Bacteria | 1674 |
| 48 | Ga0466706_135391 | 3300042599 | Bacteria | 27032 |
| 49 | Ga0466706_139865 | 3300042599 | Bacteria | 10913 |
| 50 | Ga0466698_166949 | 3300042610 | Bacteria | 73788 |
| 51 | Ga0123355_10011925 | 3300009826 | Bacteria | 13434 |
| 52 | Ga0123356_10047946 | 3300010049 | Bacteria | 3975 |
| 53 | Ga0123354_10493599 | 3300010882 | Unclassified | 959 |
| 54 | AustNasuHG_c1011241 | 3300000089 | Bacteria | 3104 |
| 55 | JGI24698J34947_10007781 | 3300002449 | Bacteria | 5885 |
| 56 | JGI24698J34947_10040392 | 3300002449 | Bacteria | 2409 |
| 57 | JGI24695J34938_10012261 | 3300002450 | Bacteria | 4556 |
| 58 | Ga0072941_1083347 | 3300005201 | Bacteria | 9886 |
| 59 | Ga0466731_287289 | 3300042622 | Bacteria | 1003 |
| 60 | Ga0466732_182889 | 3300042656 | Bacteria | 14007 |
| 61 | Ga0466718_084171 | 3300042617 | Bacteria | 16920 |
| 62 | Ga0466706_043590 | 3300042599 | Bacteria | 1937 |
| 63 | Ga0466706_079847 | 3300042599 | Bacteria | 5489 |
| 64 | Ga0466706_241647 | 3300042599 | Bacteria | 3707 |
| 65 | Ga0466700_138888 | 3300042600 | Bacteria | 3868 |
| 66 | Ga0466714_118526 | 3300042603 | Bacteria | 4067 |
| 67 | Ga0123355_10014578 | 3300009826 | Bacteria | 12301 |
| 68 | Ga0123353_10691738 | 3300010167 | Bacteria | 1433 |
| 69 | AustNasuHG_c1000759 | 3300000089 | Bacteria | 11498 |
| 70 | AustNasuHG_c1026846 | 3300000089 | Bacteria | 1782 |
| 71 | JGI24695J34938_10007688 | 3300002450 | Unclassified | 6260 |
| 72 | JGI24695J34938_10026435 | 3300002450 | Bacteria | 2758 |
| 73 | Ga0264413_110358 | 3300024493 | Bacteria | 12968 |
| 74 | Ga0466694_026831 | 3300042594 | Bacteria | 2724 |
| 75 | Ga0466699_014780 | 3300042597 | Bacteria | 7426 |
| 76 | Ga0466712_003642 | 3300042614 | Bacteria | 6398 |
| 77 | Ga0466706_227198 | 3300042599 | Bacteria | 24238 |
| 78 | Ga0123356_10064053 | 3300010049 | Unclassified | 3436 |
| 79 | Ga0123356_10705976 | 3300010049 | Bacteria | 1178 |
| 80 | Ga0123353_10011131 | 3300010167 | Bacteria | 12647 |
| 81 | Ga0123353_10193554 | 3300010167 | Bacteria | 3207 |
| 82 | Ga0123353_10206381 | 3300010167 | Bacteria | 3086 |
| 83 | JGI24698J34947_10043677 | 3300002449 | Bacteria | 2297 |
| 84 | JGI24695J34938_10000173 | 3300002450 | Bacteria | 59858 |
| 85 | JGI24695J34938_10060728 | 3300002450 | Bacteria | 1612 |
| 86 | Ga0466731_388687 | 3300042622 | Bacteria | 4749 |
| 87 | Ga0466694_203746 | 3300042594 | Unclassified | 1736 |
| 88 | Ga0466732_218653 | 3300042656 | Bacteria | 1114 |
| 89 | Ga0466712_059886 | 3300042614 | Bacteria | 32530 |
| 90 | Ga0466712_106979 | 3300042614 | Bacteria | 6327 |
| 91 | Ga0466712_116043 | 3300042614 | Bacteria | 12444 |
| 92 | Ga0466718_066808 | 3300042617 | Bacteria | 4265 |
| 93 | Ga0466718_135198 | 3300042617 | Bacteria | 11977 |
| 94 | Ga0466706_100783 | 3300042599 | Unclassified | 17562 |
| 95 | Ga0123356_10039878 | 3300010049 | Bacteria | 4375 |
| 96 | Ga0123356_10058712 | 3300010049 | Bacteria | 3588 |
| 97 | Ga0123353_10478054 | 3300010167 | Bacteria | 1824 |
| 98 | JGI24698J34947_10035887 | 3300002449 | Bacteria | 2584 |
| 99 | JGI24697J35500_11260360 | 3300002507 | Unclassified | 2977 |
| 100 | Ga0466731_197686 | 3300042622 | Bacteria | 34579 |
| 101 | Ga0415639_000516 | 3300038395 | Bacteria | 10144 |
| 102 | Ga0466712_042818 | 3300042614 | Bacteria | 1714 |
| 103 | Ga0466706_269824 | 3300042599 | Bacteria | 7798 |
| 104 | Ga0466700_327798 | 3300042600 | Bacteria | 1705 |
| 105 | Ga0466700_358849 | 3300042600 | Bacteria | 1411 |
| 106 | Ga0466720_116545 | 3300042607 | Bacteria | 3191 |
| 107 | Ga0123355_10000121 | 3300009826 | Bacteria | 89097 |
| 108 | Ga0123356_10044075 | 3300010049 | Bacteria | 4152 |
| 109 | Ga0123356_10746644 | 3300010049 | Bacteria | 1148 |
| 110 | Ga0123353_10193710 | 3300010167 | Bacteria | 3205 |
| 111 | Ga0123353_11136296 | 3300010167 | Bacteria | 1033 |
| 112 | JGI24698J34947_10011931 | 3300002449 | Bacteria | 4771 |
| 113 | JGI24698J34947_10034343 | 3300002449 | Bacteria | 2655 |
| 114 | JGI24698J34947_10110772 | 3300002449 | Bacteria | 1212 |
| 115 | Ga0072941_1000820 | 3300005201 | Bacteria | 119098 |
| 116 | Ga0072941_1029387 | 3300005201 | Bacteria | 6548 |
| 117 | Ga0466730_066395 | 3300042625 | Bacteria | 1271 |
| 118 | Ga0415639_001552 | 3300038395 | Bacteria | 12010 |
| 119 | Ga0466695_259092 | 3300042595 | Bacteria | 134193 |
| 120 | Ga0466699_374016 | 3300042597 | Bacteria | 1124 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06182 | ABC2_membrane_6 | ABC-2 family transporter protein | 80 | 312 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.