Protein Family IF07374

Metagenome Isolate
145 Members
56 Samples
120 Scaffolds
268.37 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_116043|Ga0466712_116043_7771_8712
Length
313 aa
Sequence
MRYVHRPQRGIGGGVDRAIRERGLVVESAVQCDKRNLVGSFVKVLKHKLDVCRAVAFITYKEWGAYRTHSMVSIFVGPVYFIVQYFIWTAVYSGGDTLNGIEYSQMIRYFGVTVLIGYLTMDFADWNLSMLIRTGKFLTFALRPLNHRFFAFSQKIGHRTLGFIVEFIPCILIFIFLFKVDMRSANLPWTLLSIALAFFMNFFVNYCLGMASFWIVQSEGIRSVYSLLGGVFSGMLIPLVFFPKPLQTLQFFLPFQYTSYVPAMVFLGSYSLGDVHLSIPAIVAVQAAVVLIAFIVSEILYKAAMRQFTAVGA

πŸ“Š Sample Types

Isolate 17.2%
Metagenome 82.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 50.0%
Unclassified 35.2%
Blattidae 7.4%
Scarabaeidae 3.7%
Hodotermitidae 1.9%
Kalotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
7 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
8 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
9 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
10 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
22 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
23 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
24 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
25 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
26 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
29 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
37 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
38 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
39 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
44 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
45 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
46 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
47 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
48 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
49 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
52 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
53 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
54 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
55 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
56 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_062693 3300042599 Bacteria 62593
2 Ga0466717_072992 3300042604 Bacteria 2182
3 Ga0123356_10028377 3300010049 Bacteria 5243
4 Ga0123353_10846379 3300010167 Bacteria 1254
5 AustNasuHG_c1012435 3300000089 Bacteria 2938
6 JGI24698J34947_10078219 3300002449 Unclassified 1561
7 JGI24695J34938_10000637 3300002450 Bacteria 33482
8 JGI24695J34938_10003807 3300002450 Bacteria 10261
9 Ga0466734_157093 3300042623 Bacteria 1463
10 Ga0466702_263059 3300042635 Bacteria 1218
11 Ga0123356_10272798 3300010049 Bacteria 1782
12 JGI24695J34938_10025737 3300002450 Bacteria 2807
13 Ga0466702_380134 3300042635 Bacteria 1398
14 Ga0415639_087458 3300038395 Bacteria 1841
15 Ga0466693_360222 3300042592 Unclassified 2538
16 Ga0466712_037449 3300042614 Bacteria 1901
17 Ga0466706_028263 3300042599 Bacteria 13075
18 Ga0466706_046031 3300042599 Unclassified 1637
19 Ga0466706_153272 3300042599 Bacteria 2825
20 Ga0466706_168425 3300042599 Bacteria 7982
21 Ga0466706_245273 3300042599 Unclassified 7361
22 Ga0466720_189904 3300042607 Bacteria 19102
23 Ga0466698_084003 3300042610 Bacteria 1683
24 Ga0466698_203230 3300042610 Bacteria 1246
25 Ga0123355_10201843 3300009826 Bacteria 2902
26 Ga0123356_10001228 3300010049 Bacteria 28467
27 Ga0123353_10145530 3300010167 Bacteria 3789
28 2230954224 2228664003 Bacteria 9895
29 AustNasuHG_c1001074 3300000089 Bacteria 9823
30 JGI24698J34947_10005198 3300002449 Bacteria 7139
31 JGI24698J34947_10117581 3300002449 Unclassified 1161
32 JGI24695J34938_10000575 3300002450 Bacteria 35379
33 JGI24695J34938_10001872 3300002450 Bacteria 17094
34 JGI24703J35330_11747871 3300002501 Bacteria 8748
35 JGI24703J35330_11748572 3300002501 Bacteria 20517
36 JGI24697J35500_11259319 3300002507 Bacteria 2910
37 Ga0072941_1031749 3300005201 Bacteria 2691
38 Ga0072941_1067121 3300005201 Bacteria 5812
39 Ga0466731_349246 3300042622 Bacteria 4355
40 Ga0415639_016490 3300038395 Bacteria 11177
41 Ga0466694_339879 3300042594 Bacteria 2942
42 Ga0466699_102664 3300042597 Bacteria 3339
43 Ga0466732_355958 3300042656 Bacteria 12046
44 Ga0466705_498151 3300042612 Bacteria 7131
45 Ga0466712_013867 3300042614 Unclassified 1423
46 Ga0466718_114808 3300042617 Bacteria 2446
47 Ga0466706_014531 3300042599 Bacteria 1674
48 Ga0466706_135391 3300042599 Bacteria 27032
49 Ga0466706_139865 3300042599 Bacteria 10913
50 Ga0466698_166949 3300042610 Bacteria 73788
51 Ga0123355_10011925 3300009826 Bacteria 13434
52 Ga0123356_10047946 3300010049 Bacteria 3975
53 Ga0123354_10493599 3300010882 Unclassified 959
54 AustNasuHG_c1011241 3300000089 Bacteria 3104
55 JGI24698J34947_10007781 3300002449 Bacteria 5885
56 JGI24698J34947_10040392 3300002449 Bacteria 2409
57 JGI24695J34938_10012261 3300002450 Bacteria 4556
58 Ga0072941_1083347 3300005201 Bacteria 9886
59 Ga0466731_287289 3300042622 Bacteria 1003
60 Ga0466732_182889 3300042656 Bacteria 14007
61 Ga0466718_084171 3300042617 Bacteria 16920
62 Ga0466706_043590 3300042599 Bacteria 1937
63 Ga0466706_079847 3300042599 Bacteria 5489
64 Ga0466706_241647 3300042599 Bacteria 3707
65 Ga0466700_138888 3300042600 Bacteria 3868
66 Ga0466714_118526 3300042603 Bacteria 4067
67 Ga0123355_10014578 3300009826 Bacteria 12301
68 Ga0123353_10691738 3300010167 Bacteria 1433
69 AustNasuHG_c1000759 3300000089 Bacteria 11498
70 AustNasuHG_c1026846 3300000089 Bacteria 1782
71 JGI24695J34938_10007688 3300002450 Unclassified 6260
72 JGI24695J34938_10026435 3300002450 Bacteria 2758
73 Ga0264413_110358 3300024493 Bacteria 12968
74 Ga0466694_026831 3300042594 Bacteria 2724
75 Ga0466699_014780 3300042597 Bacteria 7426
76 Ga0466712_003642 3300042614 Bacteria 6398
77 Ga0466706_227198 3300042599 Bacteria 24238
78 Ga0123356_10064053 3300010049 Unclassified 3436
79 Ga0123356_10705976 3300010049 Bacteria 1178
80 Ga0123353_10011131 3300010167 Bacteria 12647
81 Ga0123353_10193554 3300010167 Bacteria 3207
82 Ga0123353_10206381 3300010167 Bacteria 3086
83 JGI24698J34947_10043677 3300002449 Bacteria 2297
84 JGI24695J34938_10000173 3300002450 Bacteria 59858
85 JGI24695J34938_10060728 3300002450 Bacteria 1612
86 Ga0466731_388687 3300042622 Bacteria 4749
87 Ga0466694_203746 3300042594 Unclassified 1736
88 Ga0466732_218653 3300042656 Bacteria 1114
89 Ga0466712_059886 3300042614 Bacteria 32530
90 Ga0466712_106979 3300042614 Bacteria 6327
91 Ga0466712_116043 3300042614 Bacteria 12444
92 Ga0466718_066808 3300042617 Bacteria 4265
93 Ga0466718_135198 3300042617 Bacteria 11977
94 Ga0466706_100783 3300042599 Unclassified 17562
95 Ga0123356_10039878 3300010049 Bacteria 4375
96 Ga0123356_10058712 3300010049 Bacteria 3588
97 Ga0123353_10478054 3300010167 Bacteria 1824
98 JGI24698J34947_10035887 3300002449 Bacteria 2584
99 JGI24697J35500_11260360 3300002507 Unclassified 2977
100 Ga0466731_197686 3300042622 Bacteria 34579
101 Ga0415639_000516 3300038395 Bacteria 10144
102 Ga0466712_042818 3300042614 Bacteria 1714
103 Ga0466706_269824 3300042599 Bacteria 7798
104 Ga0466700_327798 3300042600 Bacteria 1705
105 Ga0466700_358849 3300042600 Bacteria 1411
106 Ga0466720_116545 3300042607 Bacteria 3191
107 Ga0123355_10000121 3300009826 Bacteria 89097
108 Ga0123356_10044075 3300010049 Bacteria 4152
109 Ga0123356_10746644 3300010049 Bacteria 1148
110 Ga0123353_10193710 3300010167 Bacteria 3205
111 Ga0123353_11136296 3300010167 Bacteria 1033
112 JGI24698J34947_10011931 3300002449 Bacteria 4771
113 JGI24698J34947_10034343 3300002449 Bacteria 2655
114 JGI24698J34947_10110772 3300002449 Bacteria 1212
115 Ga0072941_1000820 3300005201 Bacteria 119098
116 Ga0072941_1029387 3300005201 Bacteria 6548
117 Ga0466730_066395 3300042625 Bacteria 1271
118 Ga0415639_001552 3300038395 Bacteria 12010
119 Ga0466695_259092 3300042595 Bacteria 134193
120 Ga0466699_374016 3300042597 Bacteria 1124

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06182 ABC2_membrane_6 ABC-2 family transporter protein 80 312 0.88

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.