Protein Family IF07349
Metagenome
Isolate
128
Members
65
Samples
107
Scaffolds
178.05
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_053296|Ga0466712_053296_380_1000
- Length
- 206 aa
- Sequence
- MLVVRYYATFGKFLNNDFILGDKKLSRIGKKPVSIPSEAKIDYKEGQITVKGPKGELSINVHPNIDLKIENNEIVVSRKSELKKDKALHGLYRALINNLIIGVTNGFTRKLEIVGVGFRAEMKGAMVQLSLGFSHPILFIPPNNIKLETPTPNSILISGISKELVGMVASKIRMLRPPEPYKGKGIKYEGEVIRRKAGKAASKSLK
Sample Types
Isolate
16.4%
Metagenome
83.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.9%
Unclassified
20.3%
Kalotermitidae
18.6%
Rhinotermitidae
5.1%
Blattidae
5.1%
Drosophilidae
5.1%
Passalidae
3.4%
Termopsidae
3.4%
Bombycidae
1.7%
Hodotermitidae
1.7%
Apidae
1.7%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 10 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 11 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 19 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 20 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 21 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 22 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 23 | 2820030936 | Unclassified Saccharibacteria Th196P3bin64 | Isolate | Unclassified |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 27 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 28 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 29 | 2820034764 | Unclassified Saccharibacteria Nt197P3bin119 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 47 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 53 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 54 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 57 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 58 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 59 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 60 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 61 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 62 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 63 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 64 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 65 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_151463 | 3300042611 | Bacteria | 1976 |
| 2 | Ga0466705_003139 | 3300042612 | Bacteria | 1436 |
| 3 | Ga0466705_352406 | 3300042612 | Bacteria | 5590 |
| 4 | Ga0123355_10062669 | 3300009826 | Bacteria | 6001 |
| 5 | JGI24695J34938_10007117 | 3300002450 | Bacteria | 6611 |
| 6 | Ga0466702_070590 | 3300042635 | Bacteria | 1727 |
| 7 | Ga0466702_298567 | 3300042635 | Bacteria | 1646 |
| 8 | Ga0466704_317456 | 3300042643 | Bacteria | 9810 |
| 9 | Ga0466711_096823 | 3300042615 | Unclassified | 7679 |
| 10 | Ga0466723_302750 | 3300042618 | Bacteria | 42513 |
| 11 | Ga0466707_343529 | 3300042601 | Bacteria | 1285 |
| 12 | Ga0466719_138491 | 3300042606 | Bacteria | 13763 |
| 13 | Ga0466722_183422 | 3300042609 | Bacteria | 24688 |
| 14 | Ga0123356_10002433 | 3300010049 | Bacteria | 19910 |
| 15 | Ga0123356_10730209 | 3300010049 | Bacteria | 1160 |
| 16 | Ga0123356_11692871 | 3300010049 | Bacteria | 784 |
| 17 | Ga0123354_10001196 | 3300010882 | Bacteria | 30578 |
| 18 | JGI24702J35022_10000321 | 3300002462 | Bacteria | 28517 |
| 19 | Ga0264413_147249 | 3300024493 | Bacteria | 7272 |
| 20 | Ga0466692_191285 | 3300042591 | Bacteria | 67075 |
| 21 | Ga0466693_438251 | 3300042592 | Bacteria | 1230 |
| 22 | Ga0466696_050110 | 3300042596 | Bacteria | 23714 |
| 23 | Ga0466715_301768 | 3300042616 | Bacteria | 11970 |
| 24 | Ga0466728_453851 | 3300042620 | Bacteria | 38332 |
| 25 | Ga0466706_042181 | 3300042599 | Bacteria | 2557 |
| 26 | Ga0466713_077596 | 3300042602 | Bacteria | 70669 |
| 27 | Ga0123355_10243613 | 3300009826 | Unclassified | 2543 |
| 28 | Ga0123356_10005813 | 3300010049 | Bacteria | 12520 |
| 29 | Ga0123356_10567888 | 3300010049 | Unclassified | 1297 |
| 30 | Ga0104019_1005811 | 3300007150 | Bacteria | 5660 |
| 31 | Ga0466708_025071 | 3300042652 | Bacteria | 34065 |
| 32 | Ga0466725_035929 | 3300042654 | Bacteria | 3676 |
| 33 | Ga0466727_184302 | 3300042655 | Bacteria | 1756 |
| 34 | Ga0415639_128633 | 3300038395 | Bacteria | 13811 |
| 35 | Ga0466710_352868 | 3300042613 | Bacteria | 1186 |
| 36 | Ga0466707_100238 | 3300042601 | Bacteria | 32835 |
| 37 | Ga0466722_064483 | 3300042609 | Bacteria | 235903 |
| 38 | Ga0123356_10642863 | 3300010049 | Bacteria | 1228 |
| 39 | Ga0123353_10996495 | 3300010167 | Bacteria | 1126 |
| 40 | Ga0123353_11536254 | 3300010167 | Bacteria | 845 |
| 41 | Ga0466704_234724 | 3300042643 | Bacteria | 9934 |
| 42 | Ga0466704_469129 | 3300042643 | Bacteria | 8635 |
| 43 | Ga0466725_083172 | 3300042654 | Bacteria | 1168 |
| 44 | Ga0466696_406730 | 3300042596 | Bacteria | 1128 |
| 45 | Ga0466712_053296 | 3300042614 | Bacteria | 1430 |
| 46 | Ga0466711_473339 | 3300042615 | Bacteria | 4144 |
| 47 | Ga0466718_056817 | 3300042617 | Bacteria | 2909 |
| 48 | Ga0466707_146364 | 3300042601 | Bacteria | 1121 |
| 49 | Ga0466717_141665 | 3300042604 | Unclassified | 1094 |
| 50 | Ga0466717_219026 | 3300042604 | Unclassified | 1165 |
| 51 | Ga0123355_10731936 | 3300009826 | Bacteria | 1125 |
| 52 | Ga0123356_10519975 | 3300010049 | Bacteria | 1348 |
| 53 | Ga0123356_11363185 | 3300010049 | Bacteria | 871 |
| 54 | Ga0123353_10005941 | 3300010167 | Bacteria | 16150 |
| 55 | 2227469069 | 2225789004 | Bacteria | 24169 |
| 56 | Ga0466729_215447 | 3300042621 | Bacteria | 1523 |
| 57 | Ga0466718_058750 | 3300042617 | Bacteria | 21157 |
| 58 | Ga0466728_440827 | 3300042620 | Bacteria | 1251 |
| 59 | Ga0466716_282117 | 3300042605 | Bacteria | 10451 |
| 60 | Ga0466705_350326 | 3300042612 | Bacteria | 8976 |
| 61 | Ga0123355_11130624 | 3300009826 | Bacteria | 810 |
| 62 | Ga0123355_11838910 | 3300009826 | Bacteria | 569 |
| 63 | Ga0123356_10462282 | 3300010049 | Bacteria | 1419 |
| 64 | 2227078861 | 2225789003 | Unclassified | 2073 |
| 65 | 2227524734 | 2225789004 | Bacteria | 651 |
| 66 | Ga0072940_1231968 | 3300005200 | Bacteria | 3438 |
| 67 | Ga0466735_052282 | 3300042624 | Bacteria | 1113 |
| 68 | Ga0466703_296238 | 3300042636 | Bacteria | 15890 |
| 69 | Ga0466692_073917 | 3300042591 | Bacteria | 4685 |
| 70 | Ga0466696_132837 | 3300042596 | Bacteria | 1301 |
| 71 | Ga0466719_341563 | 3300042606 | Unclassified | 1104 |
| 72 | Ga0466721_020381 | 3300042608 | Bacteria | 2082 |
| 73 | Ga0466705_220327 | 3300042612 | Bacteria | 34237 |
| 74 | Ga0123355_10755658 | 3300009826 | Bacteria | 1098 |
| 75 | Ga0123356_10020898 | 3300010049 | Bacteria | 6193 |
| 76 | Ga0123356_10176966 | 3300010049 | Bacteria | 2151 |
| 77 | Ga0123353_11303708 | 3300010167 | Bacteria | 943 |
| 78 | Ga0123353_11834492 | 3300010167 | Bacteria | 752 |
| 79 | Ga0104045_1027826 | 3300007085 | Bacteria | 6019 |
| 80 | Ga0466703_060128 | 3300042636 | Bacteria | 9641 |
| 81 | Ga0466703_173416 | 3300042636 | Bacteria | 9442 |
| 82 | Ga0466724_53803 | 3300042649 | Bacteria | 7886 |
| 83 | Ga0466725_310051 | 3300042654 | Bacteria | 1784 |
| 84 | Ga0466710_419232 | 3300042613 | Bacteria | 6782 |
| 85 | Ga0466711_331423 | 3300042615 | Bacteria | 21624 |
| 86 | Ga0466700_003116 | 3300042600 | Bacteria | 1871 |
| 87 | Ga0466719_544594 | 3300042606 | Bacteria | 47826 |
| 88 | Ga0466705_033815 | 3300042612 | Bacteria | 8087 |
| 89 | Ga0123355_10006032 | 3300009826 | Bacteria | 17860 |
| 90 | Ga0123355_10051982 | 3300009826 | Unclassified | 6649 |
| 91 | Ga0123356_10001507 | 3300010049 | Bacteria | 25614 |
| 92 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 93 | Ga0123354_10010812 | 3300010882 | Bacteria | 14085 |
| 94 | Ga0072940_1132958 | 3300005200 | Bacteria | 3644 |
| 95 | Ga0466703_214606 | 3300042636 | Bacteria | 2698 |
| 96 | Ga0466708_041708 | 3300042652 | Bacteria | 26213 |
| 97 | Ga0466725_310578 | 3300042654 | Bacteria | 1019 |
| 98 | Ga0466694_221694 | 3300042594 | Bacteria | 1332 |
| 99 | Ga0466705_421116 | 3300042612 | Unclassified | 2952 |
| 100 | Ga0466712_145106 | 3300042614 | Unclassified | 1518 |
| 101 | Ga0466715_131933 | 3300042616 | Bacteria | 43814 |
| 102 | Ga0466723_137051 | 3300042618 | Bacteria | 11974 |
| 103 | Ga0466717_214640 | 3300042604 | Bacteria | 1319 |
| 104 | Ga0466717_281118 | 3300042604 | Bacteria | 2515 |
| 105 | Ga0466719_023899 | 3300042606 | Unclassified | 1888 |
| 106 | Ga0466719_177114 | 3300042606 | Bacteria | 2501 |
| 107 | Ga0466722_215646 | 3300042609 | Bacteria | 2106 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00347 | Ribosomal_L6 | Ribosomal protein L6 | 114 | 188 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.