Protein Family IF07328

Metagenome Isolate
186 Members
54 Samples
173 Scaffolds
229.91 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_007798|Ga0466712_007798_39713_40480
Length
255 aa
Sequence
LTLEKIRYTGYMRHGIEGVAFDLDGTLYPNYRFNLKLIPFILKEWRLLLAFGKARKIIRREQEKSSSPLSLQKSEIPRXXXXKDNGGFYEYQAGITAKILGVQKETIQEKIDLFIYKGWEPLFKKIKLFEKAAETLIALRNAGYKLGLLSDFPPETKLEYLGISGIWDAVLCSEHYGAIKPHPLPFTELAAAMSLSCEKILYVGNSRPYDVAGAARTGMKTAWIKSRLSPSRGDKEPKPDFVFSNYRQLYNYMLN

📊 Sample Types

Isolate 7.0%
Metagenome 93.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.6%
Unclassified 26.9%
Kalotermitidae 23.1%
Rhinotermitidae 7.7%
Termopsidae 5.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 172
Eukaryota 0
Viruses 1
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
5 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
13 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
19 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
20 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
21 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
30 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
36 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
37 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
38 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
39 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
49 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
50 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
51 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
52 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
53 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
54 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_058638 3300042612 Bacteria 1166
2 Ga0466706_035837 3300042599 Bacteria 1794
3 Ga0466706_074546 3300042599 Viruses 1158
4 Ga0466699_318924 3300042597 Bacteria 2679
5 Ga0466699_397327 3300042597 Bacteria 1632
6 Ga0466712_015740 3300042614 Bacteria 30857
7 Ga0466712_017652 3300042614 Bacteria 4425
8 Ga0466712_021504 3300042614 Bacteria 3796
9 Ga0466712_202191 3300042614 Bacteria 15142
10 Ga0466712_308093 3300042614 Bacteria 2197
11 2230954201 2228664003 Bacteria 18409
12 JGI24698J34947_10174062 3300002449 Bacteria 868
13 JGI24695J34938_10000013 3300002450 Bacteria 122387
14 JGI24695J34938_10035526 3300002450 Bacteria 2278
15 JGI24695J34938_10038121 3300002450 Bacteria 2179
16 Ga0072941_1000951 3300005201 Bacteria 23487
17 Ga0072941_1011503 3300005201 Bacteria 13279
18 Ga0123353_10289608 3300010167 Bacteria 2508
19 Ga0466731_259150 3300042622 Bacteria 2579
20 Ga0466702_404843 3300042635 Bacteria 11399
21 Ga0466705_019725 3300042612 Bacteria 14912
22 Ga0466705_208510 3300042612 Unclassified 1930
23 Ga0466707_383135 3300042601 Bacteria 1399
24 Ga0466716_014845 3300042605 Unclassified 4386
25 Ga0466720_134568 3300042607 Bacteria 1067
26 Ga0466698_347716 3300042610 Bacteria 6790
27 Ga0264413_125754 3300024493 Bacteria 1881
28 Ga0415639_007941 3300038395 Bacteria 3905
29 Ga0466690_184936 3300042590 Bacteria 4231
30 Ga0466692_057163 3300042591 Bacteria 10753
31 Ga0466692_115244 3300042591 Bacteria 40575
32 Ga0466699_062994 3300042597 Bacteria 1152
33 Ga0466712_007798 3300042614 Bacteria 50610
34 Ga0466712_225899 3300042614 Bacteria 5015
35 Ga0466711_356450 3300042615 Bacteria 10415
36 Ga0466715_629626 3300042616 Bacteria 3319
37 Ga0466718_052128 3300042617 Bacteria 2804
38 Ga0466718_145669 3300042617 Bacteria 1233
39 Ga0466718_158100 3300042617 Bacteria 2693
40 Ga0466723_200475 3300042618 Bacteria 7541
41 AustNasuHG_c1000521 3300000089 Bacteria 13487
42 JGI24698J34947_10092014 3300002449 Bacteria 1388
43 JGI24698J34947_10112605 3300002449 Bacteria 1198
44 JGI24695J34938_10000177 3300002450 Bacteria 59454
45 JGI24695J34938_10007026 3300002450 Bacteria 6669
46 JGI24695J34938_10115528 3300002450 Bacteria 1093
47 Ga0123356_10185982 3300010049 Bacteria 2104
48 Ga0466731_030547 3300042622 Bacteria 20524
49 Ga0466722_170359 3300042609 Bacteria 2818
50 Ga0466691_220592 3300042593 Bacteria 13327
51 Ga0466699_427593 3300042597 Bacteria 1123
52 Ga0466712_129939 3300042614 Bacteria 7769
53 Ga0466712_232202 3300042614 Bacteria 2652
54 JGI24698J34947_10053144 3300002449 Unclassified 2029
55 JGI24695J34938_10000242 3300002450 Bacteria 52426
56 JGI24695J34938_10001770 3300002450 Bacteria 17822
57 Ga0072941_1011472 3300005201 Bacteria 17658
58 Ga0466704_103151 3300042643 Bacteria 25700
59 Ga0466707_124597 3300042601 Bacteria 1349
60 Ga0264413_103174 3300024493 Unclassified 15378
61 Ga0264413_111552 3300024493 Bacteria 3633
62 Ga0415639_049728 3300038395 Bacteria 2930
63 Ga0466692_077967 3300042591 Bacteria 6604
64 Ga0466694_157270 3300042594 Bacteria 22768
65 Ga0466699_028446 3300042597 Bacteria 3114
66 Ga0466712_028790 3300042614 Bacteria 127971
67 Ga0466712_211801 3300042614 Bacteria 24585
68 Ga0466711_069551 3300042615 Bacteria 17057
69 Ga0466715_125238 3300042616 Bacteria 19442
70 Ga0466718_152874 3300042617 Bacteria 10502
71 Ga0466726_354784 3300042619 Bacteria 11979
72 JGI24698J34947_10029589 3300002449 Bacteria 2892
73 JGI24695J34938_10002404 3300002450 Bacteria 14374
74 Ga0072941_1062711 3300005201 Bacteria 2313
75 Ga0072941_1112051 3300005201 Bacteria 7362
76 Ga0123356_10493453 3300010049 Bacteria 1379
77 Ga0123356_11639351 3300010049 Bacteria 797
78 Ga0123353_10030888 3300010167 Bacteria 8287
79 Ga0466731_137182 3300042622 Bacteria 4567
80 Ga0466703_050000 3300042636 Bacteria 2176
81 Ga0466704_133042 3300042643 Bacteria 40449
82 Ga0466704_465943 3300042643 Unclassified 1870
83 Ga0466707_319099 3300042601 Bacteria 4207
84 Ga0466720_144603 3300042607 Bacteria 13597
85 Ga0466722_106176 3300042609 Bacteria 3913
86 Ga0466691_226861 3300042593 Bacteria 7027
87 Ga0466699_175925 3300042597 Bacteria 1611
88 Ga0466699_279353 3300042597 Bacteria 1180
89 Ga0466728_220387 3300042620 Bacteria 3241
90 JGI24698J34947_10085250 3300002449 Bacteria 1468
91 JGI24695J34938_10000894 3300002450 Bacteria 27547
92 JGI24695J34938_10001000 3300002450 Bacteria 25680
93 Ga0072941_1024129 3300005201 Bacteria 12373
94 Ga0466731_202026 3300042622 Bacteria 1607
95 Ga0466735_173092 3300042624 Bacteria 7898
96 Ga0466735_221260 3300042624 Bacteria 7186
97 Ga0466703_052657 3300042636 Unclassified 7683
98 Ga0466705_190408 3300042612 Bacteria 1687
99 Ga0466716_221955 3300042605 Bacteria 7024
100 Ga0466720_065416 3300042607 Bacteria 10911
101 Ga0466720_096903 3300042607 Unclassified 4253
102 Ga0264413_109406 3300024493 Bacteria 17503
103 Ga0415639_026790 3300038395 Bacteria 5701
104 Ga0466699_363743 3300042597 Bacteria 1061
105 Ga0466718_034439 3300042617 Bacteria 9087
106 JGI24698J34947_10000320 3300002449 Bacteria 21174
107 JGI24698J34947_10028867 3300002449 Bacteria 2936
108 JGI24695J34938_10000036 3300002450 Bacteria 101915
109 JGI24695J34938_10000415 3300002450 Bacteria 41485
110 JGI24695J34938_10000968 3300002450 Bacteria 26155
111 JGI24695J34938_10006379 3300002450 Bacteria 7106
112 JGI24695J34938_10008880 3300002450 Bacteria 5676
113 JGI24695J34938_10013570 3300002450 Bacteria 4270
114 JGI24695J34938_10026708 3300002450 Bacteria 2739
115 Ga0072941_1151018 3300005201 Bacteria 1781
116 Ga0123356_10002920 3300010049 Bacteria 18099
117 Ga0123356_10475455 3300010049 Bacteria 1402
118 Ga0123353_10639968 3300010167 Bacteria 1508
119 Ga0466703_262757 3300042636 Bacteria 13791
120 Ga0466704_231213 3300042643 Bacteria 1558
121 Ga0466705_095515 3300042612 Bacteria 15772
122 Ga0466719_238642 3300042606 Bacteria 27025
123 Ga0466720_108412 3300042607 Bacteria 17560
124 Ga0456237_0000070 3300041968 Bacteria 14191
125 Ga0466691_072542 3300042593 Bacteria 14643
126 Ga0466694_018328 3300042594 Bacteria 67528
127 Ga0466699_075758 3300042597 Bacteria 1196
128 Ga0466699_250197 3300042597 Bacteria 1871
129 Ga0466723_042368 3300042618 Bacteria 1736
130 Ga0466726_200027 3300042619 Bacteria 10984
131 JGI24698J34947_10000019 3300002449 Bacteria 41067
132 JGI24698J34947_10056895 3300002449 Unclassified 1942
133 JGI24695J34938_10000523 3300002450 Bacteria 37385
134 JGI24695J34938_10013662 3300002450 Bacteria 4253
135 Ga0072940_1112292 3300005200 Bacteria 5996
136 Ga0072941_1015223 3300005201 Bacteria 9438
137 Ga0123356_10004266 3300010049 Unclassified 14789
138 Ga0123356_10008430 3300010049 Bacteria 10250
139 Ga0123356_10025224 3300010049 Bacteria 5590
140 Ga0123356_10028621 3300010049 Bacteria 5220
141 Ga0123356_10179362 3300010049 Bacteria 2138
142 Ga0123353_10116059 3300010167 Bacteria 4308
143 Ga0123353_10424021 3300010167 Bacteria 1970
144 Ga0466729_281808 3300042621 Bacteria 2124
145 Ga0466735_054001 3300042624 Bacteria 1282
146 Ga0466708_026931 3300042652 Bacteria 55987
147 Ga0466727_200064 3300042655 Bacteria 11575
148 Ga0466727_211164 3300042655 Bacteria 6062
149 Ga0466732_085805 3300042656 Bacteria 19532
150 Ga0466707_310542 3300042601 Bacteria 1044
151 Ga0466719_460983 3300042606 Bacteria 5234
152 Ga0466720_034793 3300042607 Bacteria 41048
153 Ga0466722_018410 3300042609 Bacteria 2969
154 Ga0264413_136281 3300024493 Bacteria 4816
155 Ga0415639_001167 3300038395 Bacteria 15587
156 Ga0415639_045624 3300038395 Bacteria 6797
157 Ga0466699_122777 3300042597 Bacteria 15324
158 Ga0466699_249356 3300042597 Bacteria 2830
159 Ga0466712_131105 3300042614 Bacteria 12440
160 Ga0466715_130988 3300042616 Bacteria 3360
161 Ga0466726_360310 3300042619 Bacteria 3995
162 AustNasuHG_c1000770 3300000089 Bacteria 11416
163 JGI24698J34947_10020574 3300002449 Unclassified 3552
164 JGI24698J34947_10034796 3300002449 Unclassified 2633
165 JGI24698J34947_10046115 3300002449 Unclassified 2220
166 JGI24695J34938_10000626 3300002450 Bacteria 33678
167 JGI24695J34938_10009752 3300002450 Bacteria 5316
168 JGI24699J35502_11015980 3300002509 Bacteria 1425
169 Ga0072941_1015981 3300005201 Bacteria 4102
170 Ga0072941_1034746 3300005201 Bacteria 2379
171 Ga0123356_10020522 3300010049 Bacteria 6249
172 Ga0466704_289030 3300042643 Bacteria 1067
173 Ga0466704_466100 3300042643 Unclassified 1175

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 20 224 0.77
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 16 216 0.74

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.