Protein Family IF07312

Metagenome Metatranscriptome Isolate
143 Members
46 Samples
141 Scaffolds
266.8 Avg Length

🧬 Representative Sequence

ID
3300042613|Ga0466710_286199|Ga0466710_286199_677_1555
Length
292 aa
Sequence
MLKKMRKEGRMPLASLILAQMGVAVMFEAFFNFTSTPFQRDIPPNALYMTPQAKALQDRLAHGVKNHYFLLVTGDSGSGKTTAIRQFMAGLDANRTVALYVSESSLTPRNFYYDVLNQLGLKPRFYRGDAKRQLVKEIQTISDDRKLPVIIIDEAHLCDMEMLTEIRFLLNFDMDSRSPMSLILVGQSEIRDILKKQAYEAIAQRINLRCHIPALDHSQTVDYIAAHLIYAAGSDANIFTDVAISAIYDYSDGLPRKINRLASLCLMHAAQTGKRFVDDHMVRLIIDGELSW

📊 Sample Types

Isolate 1.4%
Metagenome 97.9%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 75.6%
Kalotermitidae 13.3%
Termopsidae 4.4%
Unclassified 4.4%
Passalidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
37 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
38 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
46 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_060489 3300042598 Bacteria 3692
2 Ga0466700_305703 3300042600 Bacteria 1879
3 Ga0466720_114137 3300042607 Bacteria 3233
4 Ga0466721_213356 3300042608 Bacteria 1319
5 Ga0466698_419185 3300042610 Bacteria 1377
6 Ga0466710_183875 3300042613 Bacteria 2125
7 Ga0123356_10062123 3300010049 Bacteria 3489
8 Ga0123356_10431491 3300010049 Unclassified 1462
9 Ga0123354_10247724 3300010882 Unclassified 1814
10 Ga0466731_235189 3300042622 Bacteria 3514
11 Ga0466731_331045 3300042622 Bacteria 1411
12 Ga0466703_290886 3300042636 Unclassified 6167
13 Ga0466656_367685 3300042550 Bacteria 1792
14 Ga0466691_105243 3300042593 Bacteria 1700
15 Ga0466701_011318 3300042598 Unclassified 4246
16 JGI24702J35022_10026009 3300002462 Bacteria 3155
17 Ga0466728_372322 3300042620 Bacteria 4054
18 Ga0123357_10124708 3300009784 Bacteria 3230
19 Ga0123356_10048201 3300010049 Bacteria 3965
20 Ga0123356_10224158 3300010049 Bacteria 1939
21 Ga0123353_10169139 3300010167 Bacteria 3471
22 Ga0123353_10190470 3300010167 Bacteria 3238
23 Ga0123353_10212934 3300010167 Bacteria 3029
24 Ga0123353_10459580 3300010167 Bacteria 1871
25 Ga0123353_10664619 3300010167 Bacteria 1471
26 Ga0466731_281778 3300042622 Bacteria 1902
27 Ga0466724_48617 3300042649 Bacteria 2376
28 Ga0415639_171683 3300038395 Unclassified 2392
29 Ga0466656_153437 3300042550 Bacteria 4379
30 Ga0466657_028777 3300042582 Bacteria 1679
31 Ga0466657_299787 3300042582 Bacteria 1424
32 Ga0466693_207753 3300042592 Bacteria 3705
33 Ga0466693_244018 3300042592 Bacteria 3784
34 Ga0466693_292041 3300042592 Bacteria 1032
35 Ga0466694_286403 3300042594 Bacteria 3602
36 AustNasuHG_c1010828 3300000089 Bacteria 3169
37 Ga0072940_1097032 3300005200 Bacteria 3178
38 Ga0072941_1729648 3300005201 Bacteria 1148
39 Ga0123356_10346650 3300010049 Bacteria 1608
40 Ga0123356_10573610 3300010049 Bacteria 1291
41 Ga0123353_10119090 3300010167 Bacteria 4246
42 Ga0123353_10637729 3300010167 Unclassified 1512
43 Ga0466725_310763 3300042654 Bacteria 2689
44 Ga0072941_1239314 3300005201 Bacteria 1306
45 Ga0466697_076571 3300042611 Bacteria 2659
46 Ga0466717_160377 3300042604 Bacteria 1299
47 Ga0466698_498038 3300042610 Bacteria 2194
48 Ga0466710_286199 3300042613 Bacteria 3760
49 Ga0466711_051061 3300042615 Bacteria 3812
50 Ga0123356_10043541 3300010049 Bacteria 4180
51 Ga0123356_10051193 3300010049 Bacteria 3842
52 Ga0123356_10093623 3300010049 Bacteria 2868
53 Ga0123356_10349246 3300010049 Bacteria 1602
54 Ga0123353_10089635 3300010167 Bacteria 4952
55 Ga0123353_10217529 3300010167 Bacteria 2991
56 Ga0123353_10336529 3300010167 Bacteria 2282
57 Ga0123353_10432779 3300010167 Bacteria 1945
58 Ga0466704_054020 3300042643 Bacteria 3197
59 Ga0466725_250295 3300042654 Bacteria 4119
60 Ga0415639_025279 3300038395 Bacteria 3396
61 Ga0415639_025301 3300038395 Bacteria 3041
62 Ga0415639_063274 3300038395 Bacteria 1320
63 Ga0466693_101878 3300042592 Bacteria 2837
64 Ga0466699_348673 3300042597 Bacteria 3542
65 Ga0466701_005721 3300042598 Bacteria 2296
66 2227261073 2225789004 Bacteria 1299
67 Ga0072940_1487452 3300005200 Bacteria 1911
68 Ga0072941_1048232 3300005201 Bacteria 2822
69 Ga0072941_1510516 3300005201 Bacteria 3369
70 Ga0466700_210188 3300042600 Bacteria 3828
71 Ga0466710_126223 3300042613 Bacteria 3366
72 Ga0466710_368683 3300042613 Unclassified 1694
73 Ga0466712_322376 3300042614 Bacteria 1322
74 Ga0466718_085155 3300042617 Bacteria 3798
75 Ga0123355_10140634 3300009826 Bacteria 3694
76 Ga0123355_10431716 3300009826 Unclassified 1675
77 Ga0123356_10035435 3300010049 Unclassified 4662
78 Ga0123356_10065608 3300010049 Bacteria 3397
79 Ga0123353_10144129 3300010167 Bacteria 3811
80 Ga0466731_028056 3300042622 Bacteria 2509
81 Ga0466703_161003 3300042636 Bacteria 4538
82 Ga0255809_1002246 3300022820 Bacteria 1342
83 Ga0466693_304147 3300042592 Bacteria 4462
84 Ga0466693_323017 3300042592 Bacteria 2244
85 Ga0466699_309232 3300042597 Bacteria 2902
86 Ga0466701_003188 3300042598 Bacteria 1801
87 JGI24702J35022_10026275 3300002462 Bacteria 3138
88 JGI24702J35022_10050950 3300002462 Bacteria 2206
89 JGI24702J35022_10073904 3300002462 Bacteria 1839
90 JGI24703J35330_11699332 3300002501 Bacteria 2005
91 Ga0072941_1002515 3300005201 Bacteria 3733
92 Ga0466697_230180 3300042611 Unclassified 1959
93 Ga0466700_027559 3300042600 Bacteria 1978
94 Ga0466700_369930 3300042600 Bacteria 5239
95 Ga0466717_069718 3300042604 Bacteria 3629
96 Ga0466697_040468 3300042611 Bacteria 2857
97 Ga0123357_10441425 3300009784 Unclassified 1139
98 Ga0123356_10049819 3300010049 Bacteria 3899
99 Ga0123353_10165650 3300010167 Bacteria 3513
100 Ga0466731_111986 3300042622 Bacteria 3069
101 Ga0466731_275738 3300042622 Bacteria 1505
102 Ga0466731_331318 3300042622 Bacteria 3757
103 Ga0466724_38256 3300042649 Bacteria 2484
104 Ga0415639_166383 3300038395 Unclassified 2985
105 Ga0466657_345293 3300042582 Bacteria 3567
106 Ga0072940_1011072 3300005200 Bacteria 7279
107 Ga0466717_243503 3300042604 Bacteria 1494
108 Ga0466710_051944 3300042613 Bacteria 1533
109 Ga0466726_462889 3300042619 Bacteria 2451
110 Ga0123355_10399249 3300009826 Bacteria 1775
111 Ga0123356_10104152 3300010049 Bacteria 2727
112 Ga0123356_10150864 3300010049 Bacteria 2307
113 Ga0123356_10160708 3300010049 Bacteria 2243
114 Ga0123356_10371107 3300010049 Bacteria 1561
115 Ga0123356_10571642 3300010049 Unclassified 1293
116 Ga0123353_10191551 3300010167 Bacteria 3227
117 Ga0466731_248546 3300042622 Bacteria 4136
118 Ga0466734_070923 3300042623 Bacteria 2196
119 Ga0466735_060149 3300042624 Bacteria 1473
120 Ga0466693_373982 3300042592 Bacteria 4070
121 Ga0466694_088232 3300042594 Bacteria 3000
122 Ga0466701_015049 3300042598 Bacteria 3869
123 JGI24695J34938_10013564 3300002450 Bacteria 4273
124 JGI24705J35276_12230733 3300002504 Bacteria 3713
125 Ga0466697_159430 3300042611 Bacteria 2346
126 Ga0466733_162263 3300042659 Unclassified 2308
127 Ga0466717_049443 3300042604 Bacteria 1383
128 Ga0466719_121379 3300042606 Bacteria 3611
129 Ga0466721_214678 3300042608 Bacteria 2035
130 Ga0123353_10452125 3300010167 Bacteria 1891
131 Ga0466731_172773 3300042622 Bacteria 1019
132 Ga0466731_382382 3300042622 Bacteria 2188
133 Ga0466702_068000 3300042635 Bacteria 1307
134 Ga0466725_030615 3300042654 Bacteria 4890
135 Ga0415639_026858 3300038395 Bacteria 2066
136 Ga0466656_174593 3300042550 Bacteria 1804
137 Ga0466691_012562 3300042593 Bacteria 3445
138 JGI24702J35022_10034199 3300002462 Bacteria 2718
139 JGI24702J35022_10177058 3300002462 Bacteria 1210
140 Ga0072941_1184198 3300005201 Bacteria 2561
141 Ga0072941_1302571 3300005201 Bacteria 2873

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_003188 Ga0466701_003188_1028_1735 235
2 3300042604 Ga0466717_160377 Ga0466717_160377_31_738 235
3 3300042613 Ga0466710_051944 Ga0466710_051944_589_1296 235
4 3300042600 Ga0466700_305703 Ga0466700_305703_874_1593 239
5 3300042607 Ga0466720_114137 Ga0466720_114137_248_1051 240
6 3300022820 Ga0255809_1002246 Ga0255809_10022462 241
7 3300042594 Ga0466694_088232 Ga0466694_088232_1693_2427 244
8 3300042611 Ga0466697_076571 Ga0466697_076571_1888_2622 244
9 3300042649 Ga0466724_38256 Ga0466724_38256_1533_2267 244
10 3300002504 JGI24705J35276_12230733 JGI24705J35276_122307333 249
11 3300005200 Ga0072940_1097032 Ga0072940_10970322 249
12 3300010049 Ga0123356_10043541 Ga0123356_100435414 254
13 3300005201 Ga0072941_1729648 Ga0072941_17296482 256
14 3300042592 Ga0466693_101878 Ga0466693_101878_817_1596 259
15 3300042592 Ga0466693_373982 Ga0466693_373982_2270_3049 259
16 3300042600 Ga0466700_027559 Ga0466700_027559_697_1506 261
17 3300038395 Ga0415639_025279 Ga0415639_025279_1884_2684 266
18 3300038395 Ga0415639_063274 Ga0415639_063274_498_1298 266
19 3300042593 Ga0466691_105243 Ga0466691_105243_186_986 266
20 3300042611 Ga0466697_040468 Ga0466697_040468_536_1336 266
21 3300042615 Ga0466711_051061 Ga0466711_051061_451_1251 266
22 3300042622 Ga0466731_331318 Ga0466731_331318_1358_2158 266
23 3300042623 Ga0466734_070923 Ga0466734_070923_477_1277 266
24 3300042636 Ga0466703_161003 Ga0466703_161003_451_1251 266
25 3300042636 Ga0466703_290886 Ga0466703_290886_3410_4210 266
26 2225789004 2227261073 2227707186 267
27 3300002462 JGI24702J35022_10034199 JGI24702J35022_100341993 267
28 3300002462 JGI24702J35022_10177058 JGI24702J35022_101770582 267
29 3300005200 Ga0072940_1487452 Ga0072940_14874522 267
30 3300005201 Ga0072941_1002515 Ga0072941_10025153 267
31 3300005201 Ga0072941_1048232 Ga0072941_10482322 267
32 3300005201 Ga0072941_1510516 Ga0072941_15105162 267
33 3300010049 Ga0123356_10035435 Ga0123356_100354353 267
34 3300010049 Ga0123356_10093623 Ga0123356_100936233 267
35 3300010167 Ga0123353_10165650 Ga0123353_101656504 267
36 3300010167 Ga0123353_10191551 Ga0123353_101915513 267
37 3300010167 Ga0123353_10212934 Ga0123353_102129342 267
38 3300010167 Ga0123353_10432779 Ga0123353_104327792 267
39 3300038395 Ga0415639_026858 Ga0415639_026858_984_1787 267
40 3300038395 Ga0415639_171683 Ga0415639_171683_563_1366 267
41 3300042550 Ga0466656_174593 Ga0466656_174593_334_1137 267
42 3300042550 Ga0466656_367685 Ga0466656_367685_456_1259 267
43 3300042582 Ga0466657_299787 Ga0466657_299787_536_1339 267
44 3300042592 Ga0466693_207753 Ga0466693_207753_631_1434 267
45 3300042592 Ga0466693_244018 Ga0466693_244018_687_1490 267
46 3300042592 Ga0466693_304147 Ga0466693_304147_1108_1911 267
47 3300042598 Ga0466701_011318 Ga0466701_011318_1157_1960 267
48 3300042598 Ga0466701_015049 Ga0466701_015049_2425_3228 267
49 3300042600 Ga0466700_369930 Ga0466700_369930_1315_2118 267
50 3300042604 Ga0466717_049443 Ga0466717_049443_461_1264 267
51 3300042608 Ga0466721_213356 Ga0466721_213356_167_970 267
52 3300042613 Ga0466710_126223 Ga0466710_126223_2150_2953 267
53 3300042619 Ga0466726_462889 Ga0466726_462889_534_1337 267
54 3300042622 Ga0466731_028056 Ga0466731_028056_212_1015 267
55 3300042622 Ga0466731_235189 Ga0466731_235189_843_1646 267
56 3300042622 Ga0466731_281778 Ga0466731_281778_235_1038 267
57 3300042622 Ga0466731_331045 Ga0466731_331045_515_1318 267
58 3300042635 Ga0466702_068000 Ga0466702_068000_19_822 267
59 3300042649 Ga0466724_48617 Ga0466724_48617_966_1769 267
60 3300042654 Ga0466725_030615 Ga0466725_030615_2570_3373 267
61 3300042654 Ga0466725_310763 Ga0466725_310763_1181_1984 267
62 iso_pr_bacteria 2820367663 2820369463 267
63 3300000089 AustNasuHG_c1010828 AustNasuHG_10108282 268
64 3300002450 JGI24695J34938_10013564 JGI24695J34938_100135643 268
65 3300002462 JGI24702J35022_10026009 JGI24702J35022_100260092 268
66 3300002462 JGI24702J35022_10026275 JGI24702J35022_100262752 268
67 3300002462 JGI24702J35022_10050950 JGI24702J35022_100509502 268
68 3300002462 JGI24702J35022_10073904 JGI24702J35022_100739042 268
69 3300005201 Ga0072941_1184198 Ga0072941_11841983 268
70 3300005201 Ga0072941_1239314 Ga0072941_12393141 268
71 3300005201 Ga0072941_1302571 Ga0072941_13025713 268
72 3300009784 Ga0123357_10124708 Ga0123357_101247081 268
73 3300009784 Ga0123357_10441425 Ga0123357_104414252 268
74 3300009826 Ga0123355_10431716 Ga0123355_104317162 268
75 3300010049 Ga0123356_10048201 Ga0123356_100482013 268
76 3300010049 Ga0123356_10049819 Ga0123356_100498191 268
77 3300010049 Ga0123356_10051193 Ga0123356_100511933 268
78 3300010049 Ga0123356_10065608 Ga0123356_100656081 268
79 3300010049 Ga0123356_10104152 Ga0123356_101041523 268
80 3300010049 Ga0123356_10160708 Ga0123356_101607083 268
81 3300010049 Ga0123356_10224158 Ga0123356_102241582 268
82 3300010049 Ga0123356_10346650 Ga0123356_103466502 268
83 3300010049 Ga0123356_10349246 Ga0123356_103492462 268
84 3300010049 Ga0123356_10371107 Ga0123356_103711071 268
85 3300010049 Ga0123356_10431491 Ga0123356_104314912 268
86 3300010049 Ga0123356_10571642 Ga0123356_105716421 268
87 3300010049 Ga0123356_10573610 Ga0123356_105736103 268
88 3300010167 Ga0123353_10089635 Ga0123353_100896351 268
89 3300010167 Ga0123353_10119090 Ga0123353_101190902 268
90 3300010167 Ga0123353_10336529 Ga0123353_103365292 268
91 3300010167 Ga0123353_10452125 Ga0123353_104521252 268
92 3300010167 Ga0123353_10459580 Ga0123353_104595802 268
93 3300010167 Ga0123353_10637729 Ga0123353_106377292 268
94 3300010167 Ga0123353_10664619 Ga0123353_106646192 268
95 3300038395 Ga0415639_025301 Ga0415639_025301_1985_2791 268
96 3300042622 Ga0466731_248546 Ga0466731_248546_2248_3054 268
97 3300042622 Ga0466731_275738 Ga0466731_275738_293_1099 268
98 3300010049 Ga0123356_10062123 Ga0123356_100621232 269
99 3300010167 Ga0123353_10144129 Ga0123353_101441294 269
100 3300038395 Ga0415639_166383 Ga0415639_166383_411_1220 269
101 3300042582 Ga0466657_028777 Ga0466657_028777_628_1437 269
102 3300042582 Ga0466657_345293 Ga0466657_345293_1018_1827 269
103 3300042592 Ga0466693_323017 Ga0466693_323017_285_1094 269
104 3300042594 Ga0466694_286403 Ga0466694_286403_563_1372 269
105 3300042597 Ga0466699_309232 Ga0466699_309232_1060_1869 269
106 3300042597 Ga0466699_348673 Ga0466699_348673_487_1296 269
107 3300042604 Ga0466717_069718 Ga0466717_069718_1363_2172 269
108 3300042610 Ga0466698_498038 Ga0466698_498038_776_1585 269
109 3300042617 Ga0466718_085155 Ga0466718_085155_2746_3555 269
110 3300042622 Ga0466731_172773 Ga0466731_172773_174_983 269
111 3300042624 Ga0466735_060149 Ga0466735_060149_34_843 269
112 3300042654 Ga0466725_250295 Ga0466725_250295_2146_2955 269
113 3300005200 Ga0072940_1011072 Ga0072940_10110726 270
114 3300010167 Ga0123353_10169139 Ga0123353_101691394 270
115 3300010882 Ga0123354_10247724 Ga0123354_102477242 270
116 3300042593 Ga0466691_012562 Ga0466691_012562_474_1286 270
117 3300042598 Ga0466701_060489 Ga0466701_060489_2156_2968 270
118 3300042604 Ga0466717_243503 Ga0466717_243503_430_1242 270
119 3300042611 Ga0466697_159430 Ga0466697_159430_1406_2218 270
120 3300042613 Ga0466710_183875 Ga0466710_183875_502_1314 270
121 3300042613 Ga0466710_368683 Ga0466710_368683_483_1295 270
122 3300042614 Ga0466712_322376 Ga0466712_322376_110_922 270
123 3300042622 Ga0466731_382382 Ga0466731_382382_1039_1851 270
124 3300002501 JGI24703J35330_11699332 JGI24703J35330_116993322 271
125 3300009826 Ga0123355_10399249 Ga0123355_103992492 271
126 3300042550 Ga0466656_153437 Ga0466656_153437_804_1619 271
127 3300042600 Ga0466700_210188 Ga0466700_210188_590_1405 271
128 3300042608 Ga0466721_214678 Ga0466721_214678_1098_1913 271
129 3300042622 Ga0466731_111986 Ga0466731_111986_1305_2120 271
130 3300042659 Ga0466733_162263 Ga0466733_162263_992_1807 271
131 3300009826 Ga0123355_10140634 Ga0123355_101406344 272
132 3300010167 Ga0123353_10190470 Ga0123353_101904701 272
133 3300010167 Ga0123353_10217529 Ga0123353_102175291 272
134 3300042592 Ga0466693_292041 Ga0466693_292041_155_973 272
135 3300042611 Ga0466697_230180 Ga0466697_230180_233_1051 272
136 3300042620 Ga0466728_372322 Ga0466728_372322_662_1480 272
137 3300010049 Ga0123356_10150864 Ga0123356_101508641 273
138 3300042643 Ga0466704_054020 Ga0466704_054020_2193_3017 274
139 iso_pr_bacteria 2820209022 2820210850 282
140 3300042606 Ga0466719_121379 Ga0466719_121379_2366_3229 287
141 3300042598 Ga0466701_005721 Ga0466701_005721_1369_2235 288
142 3300042613 Ga0466710_286199 Ga0466710_286199_677_1555 292
143 3300042610 Ga0466698_419185 Ga0466698_419185_234_1214 326

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13401 AAA_22 AAA domain 66 194 0.96
PF12775 AAA_7 P-loop containing dynein motor region 60 116 0.85
PF09848 SLFN-g3_helicase Schlafen group 3, DNA/RNA helicase domain 69 160 0.78
PF05621 TniB Bacterial TniB protein 68 197 0.73
PF13191 AAA_16 AAA ATPase domain 55 172 0.69

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF13401 GO:0016887 ATP hydrolysis activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.