Protein Family IF07260
Metagenome
Isolate
109
Members
41
Samples
103
Scaffolds
125.72
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_516195|Ga0466705_516195_634_1092
- Length
- 152 aa
- Sequence
- MIVLSKEQVERLHKKLLEQTGGLDGIRDEHLLDSALSNPFQTFDRIELYPSTAAKIARIAYGLVCNHPFVDGNKRIGTYVMMVLLELNHIEIDFSDDDIVRIGLELADGNMSDRQLLDLILERAKLTPTFRHNRPANRVGVRYAHPNLRGLR
Sample Types
Isolate
5.5%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.0%
Kalotermitidae
25.0%
Unclassified
17.5%
Rhinotermitidae
5.0%
Termopsidae
5.0%
Passalidae
2.5%
Taxonomy
Archaea
1
Bacteria
103
Eukaryota
0
Viruses
1
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 14 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_040171 | 3300042612 | Bacteria | 1817 |
| 2 | Ga0466714_094055 | 3300042603 | Bacteria | 1776 |
| 3 | Ga0466719_099674 | 3300042606 | Bacteria | 4968 |
| 4 | Ga0466698_245796 | 3300042610 | Bacteria | 1016 |
| 5 | Ga0466696_250456 | 3300042596 | Bacteria | 1189 |
| 6 | Ga0123355_10135276 | 3300009826 | Bacteria | 3787 |
| 7 | Ga0123355_10160806 | 3300009826 | Bacteria | 3384 |
| 8 | Ga0123355_10364879 | 3300009826 | Bacteria | 1898 |
| 9 | Ga0123355_10470143 | 3300009826 | Bacteria | 1571 |
| 10 | Ga0123355_10776826 | 3300009826 | Bacteria | 1075 |
| 11 | Ga0123356_10021257 | 3300010049 | Bacteria | 6128 |
| 12 | Ga0123356_10054667 | 3300010049 | Bacteria | 3719 |
| 13 | Ga0123356_10106144 | 3300010049 | Bacteria | 2704 |
| 14 | Ga0123353_10034523 | 3300010167 | Bacteria | 7895 |
| 15 | Ga0123353_10208025 | 3300010167 | Bacteria | 3071 |
| 16 | Ga0072941_1191248 | 3300005201 | Viruses | 3290 |
| 17 | Ga0466704_046361 | 3300042643 | Bacteria | 4858 |
| 18 | Ga0466704_193032 | 3300042643 | Bacteria | 7600 |
| 19 | Ga0466705_098118 | 3300042612 | Bacteria | 4161 |
| 20 | Ga0466691_156270 | 3300042593 | Bacteria | 1997 |
| 21 | Ga0123355_10008754 | 3300009826 | Bacteria | 15308 |
| 22 | Ga0123355_10035421 | 3300009826 | Bacteria | 8112 |
| 23 | Ga0123355_10090697 | 3300009826 | Bacteria | 4847 |
| 24 | Ga0123355_11314126 | 3300009826 | Bacteria | 724 |
| 25 | Ga0123354_10098553 | 3300010882 | Bacteria | 3973 |
| 26 | JGI24702J35022_10622636 | 3300002462 | Bacteria | 669 |
| 27 | Ga0466712_245137 | 3300042614 | Bacteria | 1821 |
| 28 | Ga0466699_209821 | 3300042597 | Bacteria | 3462 |
| 29 | Ga0123355_10001260 | 3300009826 | Bacteria | 35359 |
| 30 | Ga0123355_10002517 | 3300009826 | Bacteria | 25946 |
| 31 | Ga0123355_10229216 | 3300009826 | Bacteria | 2656 |
| 32 | Ga0123353_10002392 | 3300010167 | Bacteria | 23319 |
| 33 | Ga0072940_1277236 | 3300005200 | Bacteria | 1144 |
| 34 | Ga0466710_307110 | 3300042613 | Bacteria | 3037 |
| 35 | Ga0466709_196797 | 3300042648 | Bacteria | 1958 |
| 36 | Ga0466713_003281 | 3300042602 | Bacteria | 28704 |
| 37 | Ga0466719_156684 | 3300042606 | Bacteria | 15895 |
| 38 | Ga0123355_10103712 | 3300009826 | Bacteria | 4469 |
| 39 | Ga0123355_10303511 | 3300009826 | Bacteria | 2173 |
| 40 | Ga0123355_10907119 | 3300009826 | Bacteria | 956 |
| 41 | Ga0123356_11801397 | 3300010049 | Bacteria | 761 |
| 42 | Ga0123353_10614195 | 3300010167 | Bacteria | 1550 |
| 43 | Ga0123354_10948579 | 3300010882 | Bacteria | 559 |
| 44 | Ga0466705_516195 | 3300042612 | Bacteria | 1325 |
| 45 | Ga0466714_056514 | 3300042603 | Bacteria | 2506 |
| 46 | Ga0123353_10527367 | 3300010167 | Bacteria | 1711 |
| 47 | Ga0123353_10942784 | 3300010167 | Bacteria | 1169 |
| 48 | Ga0466705_439049 | 3300042612 | Bacteria | 1222 |
| 49 | Ga0466705_501991 | 3300042612 | Bacteria | 1608 |
| 50 | Ga0466710_175223 | 3300042613 | Bacteria | 1094 |
| 51 | Ga0466723_206454 | 3300042618 | Bacteria | 1212 |
| 52 | Ga0466731_303392 | 3300042622 | Bacteria | 1550 |
| 53 | Ga0466708_410068 | 3300042652 | Bacteria | 8115 |
| 54 | Ga0466697_202833 | 3300042611 | Bacteria | 1651 |
| 55 | Ga0466705_118635 | 3300042612 | Bacteria | 2729 |
| 56 | Ga0466705_379964 | 3300042612 | Bacteria | 2538 |
| 57 | Ga0466714_108770 | 3300042603 | Bacteria | 1995 |
| 58 | Ga0466722_115743 | 3300042609 | Unclassified | 1313 |
| 59 | Ga0123357_10037735 | 3300009784 | Bacteria | 6578 |
| 60 | Ga0123355_10142483 | 3300009826 | Bacteria | 3663 |
| 61 | Ga0123356_11733745 | 3300010049 | Bacteria | 775 |
| 62 | Ga0123353_10921709 | 3300010167 | Bacteria | 1186 |
| 63 | Ga0466711_271745 | 3300042615 | Bacteria | 20904 |
| 64 | Ga0466723_162287 | 3300042618 | Bacteria | 27222 |
| 65 | Ga0466704_164879 | 3300042643 | Bacteria | 1668 |
| 66 | Ga0466704_193225 | 3300042643 | Bacteria | 1799 |
| 67 | Ga0466704_612618 | 3300042643 | Bacteria | 1760 |
| 68 | Ga0466714_018939 | 3300042603 | Bacteria | 10934 |
| 69 | Ga0466722_045486 | 3300042609 | Bacteria | 28509 |
| 70 | Ga0466696_045641 | 3300042596 | Bacteria | 1847 |
| 71 | Ga0466699_038024 | 3300042597 | Bacteria | 1213 |
| 72 | Ga0123355_10523009 | 3300009826 | Bacteria | 1450 |
| 73 | Ga0123356_10002559 | 3300010049 | Bacteria | 19424 |
| 74 | Ga0123356_10685750 | 3300010049 | Bacteria | 1193 |
| 75 | Ga0123356_10731983 | 3300010049 | Bacteria | 1159 |
| 76 | Ga0123353_10039610 | 3300010167 | Bacteria | 7422 |
| 77 | Ga0123353_10093481 | 3300010167 | Archaea | 4845 |
| 78 | Ga0123353_10327913 | 3300010167 | Bacteria | 2319 |
| 79 | JGI24702J35022_10140315 | 3300002462 | Bacteria | 1348 |
| 80 | JGI24696J40584_12829453 | 3300002834 | Unclassified | 927 |
| 81 | Ga0466718_019988 | 3300042617 | Bacteria | 93292 |
| 82 | Ga0466726_052750 | 3300042619 | Bacteria | 5714 |
| 83 | Ga0466729_278915 | 3300042621 | Bacteria | 2555 |
| 84 | Ga0466734_035714 | 3300042623 | Bacteria | 1769 |
| 85 | Ga0466705_223896 | 3300042612 | Bacteria | 3827 |
| 86 | Ga0466705_250144 | 3300042612 | Unclassified | 2202 |
| 87 | Ga0466713_015662 | 3300042602 | Unclassified | 3235 |
| 88 | Ga0466714_136648 | 3300042603 | Bacteria | 1146 |
| 89 | Ga0466719_573678 | 3300042606 | Bacteria | 5621 |
| 90 | Ga0466721_370520 | 3300042608 | Bacteria | 3640 |
| 91 | Ga0123355_10804237 | 3300009826 | Bacteria | 1047 |
| 92 | Ga0123355_11328622 | 3300009826 | Bacteria | 718 |
| 93 | Ga0123356_10107233 | 3300010049 | Bacteria | 2691 |
| 94 | Ga0123356_10540265 | 3300010049 | Bacteria | 1326 |
| 95 | Ga0123356_11678216 | 3300010049 | Bacteria | 788 |
| 96 | Ga0123356_11684520 | 3300010049 | Bacteria | 786 |
| 97 | IMNBL1DRAFT_c0026990 | 3300000062 | Bacteria | 2170 |
| 98 | Ga0072940_1330225 | 3300005200 | Bacteria | 1363 |
| 99 | Ga0072941_1520506 | 3300005201 | Bacteria | 1342 |
| 100 | Ga0466715_409318 | 3300042616 | Bacteria | 2848 |
| 101 | Ga0466704_390625 | 3300042643 | Bacteria | 1487 |
| 102 | Ga0466708_264954 | 3300042652 | Bacteria | 2772 |
| 103 | Ga0466727_277247 | 3300042655 | Bacteria | 1206 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02661 | Fic | Fic/DOC family | 4 | 85 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.