Protein Family IF07248

Metagenome Isolate
128 Members
50 Samples
114 Scaffolds
278 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_487658|Ga0466705_487658_190_1173
Length
327 aa
Sequence
MQKKLRSSALCYIRPVTEFQSTASKFSGRTIINQFAEAYPKGRCLPDRGAGTMKERNELEKFAAEIRIAALESIGKCGFGHVGGSMSIADVLAVLYGDVMKYDAKNNRWEERDWLIVSKGHAGPAVYAALAIKGFFDREMLYTLNQPGTNLPSHCDANKTPGIDMTTGSLGQGLSLGAGVAIGNKMQGRDSYAYVIIGDGESQEGQVWEAVMFAAQSEIDNLILFVDNNKDQIDGYTKTINNVENFEDKFRAFNWDVRRVDGHDVIAIEKAVEKAKAEKGMPSAIVLDTVKGKGCSFCEGVRGNHHIQVTQEQISEAVQTLRSQYCV

📊 Sample Types

Isolate 10.9%
Metagenome 89.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 32.7%
Kalotermitidae 28.6%
Termitidae 24.5%
Termopsidae 4.1%
Hodotermitidae 2.0%
Passalidae 2.0%
Blaberidae 2.0%
Rhinotermitidae 2.0%
Tenebrionidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
2 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
3 2820038975 Unclassified Saccharibacteria Emb289P3bin132 Isolate Unclassified
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
14 2772190975 Treponema sp. RmG30 Isolate Blaberidae
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
17 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
18 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
19 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
20 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
31 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2820176377 Unclassified Planctomycetes Th196P3bin111 Isolate Unclassified
38 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
39 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
44 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
49 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_050551 3300042612 Bacteria 17069
2 Ga0123355_10063903 3300009826 Bacteria 5934
3 Ga0123356_10534780 3300010049 Bacteria 1332
4 Ga0123353_10000006 3300010167 Bacteria 279423
5 Ga0123353_10044500 3300010167 Bacteria 7038
6 Ga0123353_10492702 3300010167 Bacteria 1789
7 Ga0123354_10110002 3300010882 Bacteria 3647
8 Ga0466719_045950 3300042606 Unclassified 3415
9 Ga0466719_269883 3300042606 Bacteria 2024
10 Ga0466719_367498 3300042606 Bacteria 2887
11 Ga0466690_096159 3300042590 Bacteria 1186
12 Ga0466711_101269 3300042615 Bacteria 28356
13 Ga0466709_058781 3300042648 Bacteria 14197
14 Ga0562379_1937 3300056790 Bacteria 20148
15 Ga0123355_10411028 3300009826 Bacteria 1737
16 Ga0466707_393556 3300042601 Bacteria 121495
17 Ga0466696_430987 3300042596 Bacteria 8140
18 Ga0466712_023799 3300042614 Bacteria 49566
19 Ga0466723_264021 3300042618 Bacteria 3812
20 Ga0466726_267047 3300042619 Bacteria 4853
21 Ga0466728_324178 3300042620 Bacteria 2699
22 Ga0466728_432742 3300042620 Bacteria 7099
23 Ga0466708_027653 3300042652 Bacteria 2585
24 Ga0466708_449842 3300042652 Bacteria 4635
25 2227312465 2225789004 Bacteria 1203
26 Ga0072941_1000668 3300005201 Bacteria 9324
27 Ga0466733_059354 3300042659 Bacteria 1292
28 Ga0466733_120859 3300042659 Bacteria 5142
29 Ga0123353_10397144 3300010167 Bacteria 2054
30 Ga0123353_10548429 3300010167 Bacteria 1668
31 Ga0466706_052515 3300042599 Bacteria 1328
32 Ga0466716_257018 3300042605 Bacteria 1260
33 Ga0466691_082745 3300042593 Bacteria 1574
34 Ga0466696_358657 3300042596 Bacteria 2132
35 Ga0466715_215582 3300042616 Bacteria 3140
36 Ga0466715_369538 3300042616 Bacteria 8814
37 Ga0466728_129199 3300042620 Bacteria 1577
38 Ga0466703_247142 3300042636 Bacteria 96407
39 Ga0466704_076757 3300042643 Bacteria 271570
40 Ga0466725_303896 3300042654 Bacteria 2125
41 Ga0466727_133423 3300042655 Bacteria 2087
42 Ga0466732_018252 3300042656 Bacteria 25875
43 Ga0123357_10364475 3300009784 Bacteria 1364
44 Ga0123356_10044966 3300010049 Bacteria 4109
45 Ga0123353_10000193 3300010167 Bacteria 77168
46 Ga0123353_10735367 3300010167 Bacteria 1377
47 Ga0123353_11026920 3300010167 Bacteria 1104
48 Ga0466706_020567 3300042599 Bacteria 2164
49 Ga0466713_137088 3300042602 Bacteria 5198
50 Ga0466716_246630 3300042605 Bacteria 4295
51 Ga0466719_566806 3300042606 Bacteria 4540
52 Ga0466691_000125 3300042593 Bacteria 15560
53 Ga0466705_487658 3300042612 Bacteria 1720
54 Ga0466723_093420 3300042618 Bacteria 10502
55 Ga0466723_220366 3300042618 Bacteria 3367
56 Ga0123355_10137779 3300009826 Unclassified 3744
57 Ga0123356_10001529 3300010049 Bacteria 25478
58 Ga0123356_10011290 3300010049 Bacteria 8716
59 Ga0123353_10053808 3300010167 Bacteria 6433
60 Ga0123353_10705192 3300010167 Bacteria 1415
61 Ga0466691_058565 3300042593 Bacteria 12617
62 Ga0466696_342148 3300042596 Bacteria 66133
63 Ga0466703_089301 3300042636 Bacteria 25953
64 Ga0466703_301969 3300042636 Bacteria 2216
65 Ga0466708_047224 3300042652 Bacteria 4922
66 Ga0466713_077177 3300042602 Bacteria 4545
67 Ga0466717_006210 3300042604 Bacteria 1388
68 Ga0466719_466912 3300042606 Bacteria 7998
69 Ga0466705_449164 3300042612 Bacteria 1196
70 Ga0466705_487151 3300042612 Bacteria 2896
71 Ga0466723_022774 3300042618 Bacteria 1738
72 Ga0466726_104824 3300042619 Bacteria 3350
73 Ga0466703_040307 3300042636 Bacteria 17717
74 Ga0466704_025649 3300042643 Bacteria 3479
75 Ga0123357_10043089 3300009784 Bacteria 6132
76 Ga0123355_10093440 3300009826 Bacteria 4761
77 Ga0123355_10162085 3300009826 Bacteria 3366
78 Ga0123356_10058362 3300010049 Unclassified 3598
79 Ga0123353_10118811 3300010167 Bacteria 4251
80 Ga0123353_11118752 3300010167 Unclassified 1043
81 Ga0466706_128056 3300042599 Bacteria 4576
82 Ga0466707_047554 3300042601 Bacteria 59264
83 Ga0466716_433218 3300042605 Bacteria 1060
84 Ga0466722_184632 3300042609 Bacteria 9749
85 Ga0466690_049425 3300042590 Bacteria 5034
86 Ga0466695_379021 3300042595 Bacteria 1985
87 Ga0466696_124621 3300042596 Bacteria 2730
88 Ga0466696_286446 3300042596 Bacteria 6088
89 Ga0466705_434363 3300042612 Bacteria 2163
90 Ga0466711_229149 3300042615 Bacteria 3948
91 Ga0466723_142062 3300042618 Bacteria 2739
92 Ga0466726_040232 3300042619 Bacteria 21530
93 Ga0466703_138069 3300042636 Bacteria 8499
94 Ga0466704_072057 3300042643 Bacteria 8432
95 Ga0466727_108208 3300042655 Bacteria 10340
96 AustNasuHG_c1007244 3300000089 Bacteria 3947
97 Ga0123357_10000238 3300009784 Bacteria 52234
98 Ga0466705_115121 3300042612 Bacteria 5980
99 Ga0123355_10361568 3300009826 Bacteria 1911
100 Ga0123353_10019141 3300010167 Bacteria 10159
101 Ga0123353_10735003 3300010167 Bacteria 1377
102 Ga0466706_075594 3300042599 Bacteria 269977
103 Ga0466706_121768 3300042599 Bacteria 3063
104 Ga0466713_036428 3300042602 Bacteria 19604
105 Ga0466722_074798 3300042609 Bacteria 2053
106 Ga0466690_338852 3300042590 Bacteria 2934
107 Ga0466705_460621 3300042612 Bacteria 2670
108 Ga0466715_351736 3300042616 Bacteria 15874
109 Ga0466723_144955 3300042618 Bacteria 5902
110 Ga0466723_176637 3300042618 Bacteria 12703
111 Ga0466723_254467 3300042618 Bacteria 2704
112 Ga0466726_452744 3300042619 Bacteria 3426
113 Ga0466704_467352 3300042643 Bacteria 2075
114 Ga0068305_10001566 3300005083 Bacteria 16174

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain 62 319 0.94
PF00676 E1_dh Dehydrogenase E1 component 162 277 0.92
PF09364 XFP_N XFP N-terminal domain 141 272 0.84
PF13292 DXP_synthase_N 1-deoxy-D-xylulose-5-phosphate synthase 56 230 0.75

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00676 GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.