Protein Family IF07244
Metagenome
Isolate
136
Members
37
Samples
134
Scaffolds
241.11
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_474887|Ga0466705_474887_4270_4995
- Length
- 241 aa
- Sequence
- MVYEFEGRTEKEAIDQAAEALGLGKDDFDVEILEVQRSGLFKKGYVKIRVHLNQPASGALEHTHTEEADELRAVSEGSSQTRFNDPEAKNDFEQKIIDFTEGIVQRMGYEGKVSVLFREDRKIGFKIDSAYSSILIGKKGKNLDALQLLINIYAGRLGQEDVRVILDTENYRIRREESLVRLAYTVADRVRENRGSVLLEPMNPFDRRLIHTTLNDIADVETKSEGDGLYKQVRVYYRGAH
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
35.1%
Unclassified
10.8%
Rhinotermitidae
8.1%
Termopsidae
8.1%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_082030 | 3300042656 | Bacteria | 3241 |
| 2 | Ga0466732_159712 | 3300042656 | Bacteria | 1254 |
| 3 | Ga0466711_443171 | 3300042615 | Bacteria | 4566 |
| 4 | Ga0466715_181733 | 3300042616 | Bacteria | 18508 |
| 5 | Ga0466726_465463 | 3300042619 | Bacteria | 1218 |
| 6 | Ga0466703_031739 | 3300042636 | Bacteria | 1012 |
| 7 | Ga0466703_059483 | 3300042636 | Bacteria | 4202 |
| 8 | Ga0466704_514167 | 3300042643 | Bacteria | 27255 |
| 9 | Ga0466708_038163 | 3300042652 | Bacteria | 5560 |
| 10 | Ga0466708_286264 | 3300042652 | Bacteria | 107074 |
| 11 | Ga0466716_503141 | 3300042605 | Unclassified | 11887 |
| 12 | Ga0466720_125366 | 3300042607 | Bacteria | 14214 |
| 13 | Ga0466720_162968 | 3300042607 | Unclassified | 2537 |
| 14 | Ga0466720_229034 | 3300042607 | Unclassified | 1155 |
| 15 | Ga0466722_149770 | 3300042609 | Bacteria | 4974 |
| 16 | JGI24698J34947_10003159 | 3300002449 | Bacteria | 8914 |
| 17 | Ga0466690_227918 | 3300042590 | Bacteria | 7338 |
| 18 | Ga0466691_044091 | 3300042593 | Bacteria | 8339 |
| 19 | Ga0466691_208717 | 3300042593 | Bacteria | 1365 |
| 20 | Ga0466732_015610 | 3300042656 | Bacteria | 1026 |
| 21 | Ga0466732_240513 | 3300042656 | Bacteria | 1629 |
| 22 | Ga0466712_145163 | 3300042614 | Bacteria | 1715 |
| 23 | Ga0466711_100257 | 3300042615 | Bacteria | 3138 |
| 24 | Ga0466718_050159 | 3300042617 | Bacteria | 12154 |
| 25 | Ga0466718_152669 | 3300042617 | Unclassified | 2630 |
| 26 | Ga0466723_128836 | 3300042618 | Bacteria | 1484 |
| 27 | Ga0466703_113881 | 3300042636 | Unclassified | 35758 |
| 28 | Ga0466704_499925 | 3300042643 | Bacteria | 6027 |
| 29 | Ga0466708_025250 | 3300042652 | Bacteria | 9150 |
| 30 | Ga0466708_046682 | 3300042652 | Bacteria | 25817 |
| 31 | Ga0466717_177897 | 3300042604 | Bacteria | 1378 |
| 32 | Ga0466720_062622 | 3300042607 | Unclassified | 2096 |
| 33 | Ga0466720_069052 | 3300042607 | Bacteria | 5305 |
| 34 | Ga0466720_098651 | 3300042607 | Bacteria | 30361 |
| 35 | Ga0466720_101410 | 3300042607 | Bacteria | 24290 |
| 36 | Ga0466720_135143 | 3300042607 | Bacteria | 1619 |
| 37 | JGI24695J34938_10009299 | 3300002450 | Bacteria | 5477 |
| 38 | Ga0074263_104634 | 3300005485 | Unclassified | 2107 |
| 39 | Ga0456237_0001122 | 3300041968 | Bacteria | 4227 |
| 40 | Ga0466691_164822 | 3300042593 | Bacteria | 10794 |
| 41 | Ga0466691_216629 | 3300042593 | Bacteria | 7663 |
| 42 | Ga0466694_331422 | 3300042594 | Bacteria | 2024 |
| 43 | Ga0466696_173607 | 3300042596 | Bacteria | 4658 |
| 44 | Ga0466696_348464 | 3300042596 | Bacteria | 4833 |
| 45 | Ga0466696_473033 | 3300042596 | Bacteria | 1440 |
| 46 | Ga0466711_394207 | 3300042615 | Bacteria | 10941 |
| 47 | Ga0466715_009100 | 3300042616 | Bacteria | 1028 |
| 48 | Ga0466723_041259 | 3300042618 | Bacteria | 4999 |
| 49 | Ga0466703_024796 | 3300042636 | Bacteria | 23973 |
| 50 | Ga0466704_508947 | 3300042643 | Bacteria | 7084 |
| 51 | Ga0466709_384351 | 3300042648 | Bacteria | 6861 |
| 52 | Ga0466727_001936 | 3300042655 | Unclassified | 1641 |
| 53 | Ga0466707_130648 | 3300042601 | Bacteria | 2172 |
| 54 | Ga0466716_457168 | 3300042605 | Bacteria | 4716 |
| 55 | Ga0466719_191828 | 3300042606 | Bacteria | 47243 |
| 56 | Ga0466720_196471 | 3300042607 | Bacteria | 1126 |
| 57 | JGI24695J34938_10000762 | 3300002450 | Bacteria | 30258 |
| 58 | Ga0466692_013319 | 3300042591 | Bacteria | 4719 |
| 59 | Ga0466732_053014 | 3300042656 | Bacteria | 12774 |
| 60 | Ga0466705_474887 | 3300042612 | Bacteria | 10000 |
| 61 | Ga0466712_063503 | 3300042614 | Bacteria | 1368 |
| 62 | Ga0466712_145256 | 3300042614 | Bacteria | 6111 |
| 63 | Ga0466711_364358 | 3300042615 | Bacteria | 5729 |
| 64 | Ga0466718_020336 | 3300042617 | Bacteria | 1566 |
| 65 | Ga0466718_086242 | 3300042617 | Bacteria | 67871 |
| 66 | Ga0466723_203165 | 3300042618 | Bacteria | 40822 |
| 67 | Ga0466723_243581 | 3300042618 | Bacteria | 11996 |
| 68 | Ga0466726_392187 | 3300042619 | Bacteria | 30982 |
| 69 | Ga0466709_092971 | 3300042648 | Bacteria | 8108 |
| 70 | Ga0466709_177148 | 3300042648 | Bacteria | 37354 |
| 71 | Ga0466708_061435 | 3300042652 | Bacteria | 15050 |
| 72 | Ga0466708_134592 | 3300042652 | Bacteria | 3904 |
| 73 | Ga0466708_389577 | 3300042652 | Bacteria | 54586 |
| 74 | Ga0466716_472827 | 3300042605 | Bacteria | 2674 |
| 75 | JGI24698J34947_10044404 | 3300002449 | Unclassified | 2275 |
| 76 | Ga0466690_119417 | 3300042590 | Bacteria | 7022 |
| 77 | Ga0466691_199482 | 3300042593 | Bacteria | 2187 |
| 78 | Ga0466694_194730 | 3300042594 | Bacteria | 19746 |
| 79 | Ga0466718_116948 | 3300042617 | Bacteria | 1633 |
| 80 | Ga0466723_332331 | 3300042618 | Bacteria | 12376 |
| 81 | Ga0466728_025478 | 3300042620 | Bacteria | 4717 |
| 82 | Ga0466728_311119 | 3300042620 | Bacteria | 2921 |
| 83 | Ga0466704_502888 | 3300042643 | Bacteria | 2116 |
| 84 | Ga0466708_390230 | 3300042652 | Bacteria | 2159 |
| 85 | Ga0466720_064341 | 3300042607 | Unclassified | 2488 |
| 86 | Ga0466722_073828 | 3300042609 | Bacteria | 5448 |
| 87 | Ga0466690_103885 | 3300042590 | Unclassified | 2798 |
| 88 | Ga0466691_078886 | 3300042593 | Bacteria | 14766 |
| 89 | Ga0466732_103500 | 3300042656 | Bacteria | 2524 |
| 90 | Ga0466712_199973 | 3300042614 | Bacteria | 9634 |
| 91 | Ga0466715_052295 | 3300042616 | Bacteria | 6307 |
| 92 | Ga0466715_188040 | 3300042616 | Bacteria | 2278 |
| 93 | Ga0466723_048028 | 3300042618 | Bacteria | 2960 |
| 94 | Ga0466728_030518 | 3300042620 | Bacteria | 12433 |
| 95 | Ga0123353_10229492 | 3300010167 | Bacteria | 2896 |
| 96 | Ga0466703_034952 | 3300042636 | Bacteria | 5469 |
| 97 | Ga0466704_592399 | 3300042643 | Bacteria | 9948 |
| 98 | Ga0466700_240290 | 3300042600 | Bacteria | 2242 |
| 99 | Ga0466716_014847 | 3300042605 | Bacteria | 17267 |
| 100 | Ga0466716_405324 | 3300042605 | Bacteria | 6204 |
| 101 | Ga0466720_030532 | 3300042607 | Bacteria | 8184 |
| 102 | Ga0466720_043757 | 3300042607 | Bacteria | 6358 |
| 103 | Ga0466720_074880 | 3300042607 | Bacteria | 9763 |
| 104 | Ga0466720_078393 | 3300042607 | Bacteria | 7021 |
| 105 | AustNasuHG_c1009848 | 3300000089 | Bacteria | 3344 |
| 106 | JGI24698J34947_10053151 | 3300002449 | Bacteria | 2029 |
| 107 | JGI24702J35022_10020052 | 3300002462 | Bacteria | 3633 |
| 108 | Ga0466692_096759 | 3300042591 | Unclassified | 11139 |
| 109 | Ga0466705_006106 | 3300042612 | Bacteria | 6416 |
| 110 | Ga0466732_324658 | 3300042656 | Bacteria | 6422 |
| 111 | Ga0466712_052395 | 3300042614 | Bacteria | 28135 |
| 112 | Ga0466711_030716 | 3300042615 | Bacteria | 19173 |
| 113 | Ga0466711_095252 | 3300042615 | Bacteria | 15909 |
| 114 | Ga0466711_239063 | 3300042615 | Bacteria | 11313 |
| 115 | Ga0466723_263126 | 3300042618 | Bacteria | 4010 |
| 116 | Ga0466726_386317 | 3300042619 | Bacteria | 2426 |
| 117 | Ga0123353_10031830 | 3300010167 | Bacteria | 8180 |
| 118 | Ga0466735_163019 | 3300042624 | Bacteria | 8123 |
| 119 | Ga0466700_191976 | 3300042600 | Bacteria | 1325 |
| 120 | Ga0466717_118979 | 3300042604 | Bacteria | 1045 |
| 121 | Ga0466716_023953 | 3300042605 | Bacteria | 9778 |
| 122 | Ga0466719_171793 | 3300042606 | Bacteria | 23489 |
| 123 | Ga0466720_116644 | 3300042607 | Bacteria | 39029 |
| 124 | Ga0466720_163599 | 3300042607 | Bacteria | 8568 |
| 125 | Ga0466692_067310 | 3300042591 | Bacteria | 26519 |
| 126 | Ga0466691_113013 | 3300042593 | Bacteria | 9337 |
| 127 | Ga0466704_431036 | 3300042643 | Bacteria | 2845 |
| 128 | Ga0466708_310211 | 3300042652 | Bacteria | 8287 |
| 129 | Ga0466727_222586 | 3300042655 | Bacteria | 2477 |
| 130 | Ga0466713_112814 | 3300042602 | Bacteria | 4035 |
| 131 | Ga0466716_344326 | 3300042605 | Bacteria | 3756 |
| 132 | Ga0074263_114403 | 3300005485 | Bacteria | 3356 |
| 133 | Ga0466690_145240 | 3300042590 | Bacteria | 3997 |
| 134 | Ga0466694_069556 | 3300042594 | Bacteria | 2332 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01424 | GO:0003676 | nucleic acid binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.