Protein Family IF07183
Metagenome
Isolate
139
Members
33
Samples
136
Scaffolds
189.29
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_306668|Ga0466705_306668_3826_4503
- Length
- 225 aa
- Sequence
- LYRYYLCKDKQYQFDLYLKADYFCIVINTNYSLKQKNMQAIINSQLPEFKVQAYQNGNFRTVTNADLQGKWAIFFFYPADFTFVCPTELGDMADKYAKFQELGVEVYSVSTDTHFVHKAWHDASETIRKIKYPMLADPTGALSRAFGVLIEEDGVAYRGTFLVNPEGKIKVTEIHDNGIGRDADELLRKVEAAQFVATHPDEVCPAKWKKGDATLKPSIDLVGKI
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
39.4%
Termitidae
12.1%
Unclassified
12.1%
Termopsidae
12.1%
Rhinotermitidae
9.1%
Passalidae
6.1%
Blattidae
6.1%
Hodotermitidae
3.0%
Taxonomy
Archaea
0
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 5 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 11 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_145179 | 3300042612 | Bacteria | 4535 |
| 2 | Ga0466733_057215 | 3300042659 | Unclassified | 1911 |
| 3 | Ga0466690_429084 | 3300042590 | Bacteria | 1724 |
| 4 | Ga0466703_146869 | 3300042636 | Bacteria | 11356 |
| 5 | Ga0466704_278048 | 3300042643 | Bacteria | 35404 |
| 6 | Ga0466704_328102 | 3300042643 | Bacteria | 13635 |
| 7 | Ga0466708_212527 | 3300042652 | Unclassified | 1562 |
| 8 | Ga0466727_121620 | 3300042655 | Bacteria | 5943 |
| 9 | Ga0466713_070366 | 3300042602 | Bacteria | 55899 |
| 10 | Ga0466722_068822 | 3300042609 | Bacteria | 12369 |
| 11 | Ga0466722_074972 | 3300042609 | Bacteria | 4369 |
| 12 | Ga0466715_026739 | 3300042616 | Bacteria | 2517 |
| 13 | Ga0466715_216221 | 3300042616 | Bacteria | 1955 |
| 14 | Ga0466723_083098 | 3300042618 | Bacteria | 6092 |
| 15 | Ga0466723_192823 | 3300042618 | Bacteria | 15084 |
| 16 | Ga0466728_157166 | 3300042620 | Bacteria | 7881 |
| 17 | Ga0466690_177182 | 3300042590 | Bacteria | 15895 |
| 18 | Ga0466692_052227 | 3300042591 | Bacteria | 6624 |
| 19 | Ga0466735_145750 | 3300042624 | Bacteria | 3097 |
| 20 | Ga0466735_222151 | 3300042624 | Unclassified | 1128 |
| 21 | Ga0466709_084204 | 3300042648 | Bacteria | 3564 |
| 22 | Ga0466709_337430 | 3300042648 | Bacteria | 5419 |
| 23 | Ga0466725_459992 | 3300042654 | Bacteria | 11425 |
| 24 | Ga0466706_016196 | 3300042599 | Bacteria | 5635 |
| 25 | Ga0466716_225048 | 3300042605 | Bacteria | 4547 |
| 26 | Ga0466722_057965 | 3300042609 | Bacteria | 12391 |
| 27 | Ga0466722_101396 | 3300042609 | Bacteria | 2443 |
| 28 | IMNBL1DRAFT_c0036769 | 3300000062 | Unclassified | 1705 |
| 29 | Ga0466711_000212 | 3300042615 | Bacteria | 21541 |
| 30 | Ga0466711_482027 | 3300042615 | Unclassified | 2654 |
| 31 | Ga0466715_297753 | 3300042616 | Bacteria | 3659 |
| 32 | Ga0466715_339921 | 3300042616 | Bacteria | 7303 |
| 33 | Ga0466715_578588 | 3300042616 | Bacteria | 9243 |
| 34 | Ga0466728_004826 | 3300042620 | Bacteria | 1365 |
| 35 | Ga0466728_224001 | 3300042620 | Bacteria | 15029 |
| 36 | Ga0466729_150466 | 3300042621 | Bacteria | 5149 |
| 37 | Ga0466729_153704 | 3300042621 | Bacteria | 53339 |
| 38 | Ga0466735_097926 | 3300042624 | Bacteria | 1980 |
| 39 | Ga0466704_363924 | 3300042643 | Bacteria | 9661 |
| 40 | Ga0466704_473139 | 3300042643 | Bacteria | 5589 |
| 41 | Ga0466727_117113 | 3300042655 | Bacteria | 3963 |
| 42 | Ga0466727_171228 | 3300042655 | Bacteria | 14015 |
| 43 | Ga0466707_118840 | 3300042601 | Bacteria | 2544 |
| 44 | Ga0466707_356482 | 3300042601 | Bacteria | 19302 |
| 45 | Ga0466719_492002 | 3300042606 | Bacteria | 3496 |
| 46 | Ga0466722_138486 | 3300042609 | Bacteria | 4923 |
| 47 | Ga0068305_10087821 | 3300005083 | Bacteria | 7893 |
| 48 | Ga0466711_271880 | 3300042615 | Bacteria | 44119 |
| 49 | Ga0466715_107490 | 3300042616 | Bacteria | 5838 |
| 50 | Ga0466715_172953 | 3300042616 | Bacteria | 8309 |
| 51 | Ga0466726_121475 | 3300042619 | Bacteria | 2412 |
| 52 | Ga0466729_096811 | 3300042621 | Bacteria | 1996 |
| 53 | Ga0466705_306668 | 3300042612 | Bacteria | 5957 |
| 54 | Ga0466735_167834 | 3300042624 | Unclassified | 1948 |
| 55 | Ga0466706_182722 | 3300042599 | Bacteria | 29146 |
| 56 | Ga0466707_192426 | 3300042601 | Bacteria | 6724 |
| 57 | Ga0466707_398461 | 3300042601 | Bacteria | 9723 |
| 58 | Ga0466719_056719 | 3300042606 | Unclassified | 1811 |
| 59 | Ga0466719_523105 | 3300042606 | Unclassified | 2444 |
| 60 | Ga0466719_532052 | 3300042606 | Bacteria | 4360 |
| 61 | IMNBL1DRAFT_c0000475 | 3300000062 | Bacteria | 33592 |
| 62 | Ga0466705_431915 | 3300042612 | Bacteria | 29542 |
| 63 | Ga0466711_035869 | 3300042615 | Bacteria | 1304 |
| 64 | Ga0466711_081269 | 3300042615 | Bacteria | 2996 |
| 65 | Ga0466715_447523 | 3300042616 | Bacteria | 38085 |
| 66 | Ga0466726_334356 | 3300042619 | Bacteria | 1869 |
| 67 | Ga0466696_326780 | 3300042596 | Bacteria | 2745 |
| 68 | Ga0466729_203880 | 3300042621 | Bacteria | 4974 |
| 69 | Ga0466703_031055 | 3300042636 | Unclassified | 1553 |
| 70 | Ga0466703_186772 | 3300042636 | Bacteria | 9966 |
| 71 | Ga0466704_518639 | 3300042643 | Bacteria | 11405 |
| 72 | Ga0466708_090546 | 3300042652 | Bacteria | 12205 |
| 73 | Ga0466727_167098 | 3300042655 | Bacteria | 1860 |
| 74 | Ga0466707_081263 | 3300042601 | Bacteria | 11553 |
| 75 | Ga0466719_234023 | 3300042606 | Bacteria | 8613 |
| 76 | IMNBL1DRAFT_c0007827 | 3300000062 | Bacteria | 5546 |
| 77 | Ga0466710_241070 | 3300042613 | Bacteria | 2796 |
| 78 | Ga0466711_125992 | 3300042615 | Bacteria | 2366 |
| 79 | Ga0466715_134890 | 3300042616 | Bacteria | 4736 |
| 80 | Ga0466726_069792 | 3300042619 | Bacteria | 7273 |
| 81 | Ga0466726_162837 | 3300042619 | Bacteria | 13744 |
| 82 | Ga0466703_337757 | 3300042636 | Bacteria | 1733 |
| 83 | Ga0466704_253317 | 3300042643 | Bacteria | 5002 |
| 84 | Ga0466725_317940 | 3300042654 | Bacteria | 1627 |
| 85 | Ga0466727_031563 | 3300042655 | Bacteria | 12423 |
| 86 | Ga0466727_126115 | 3300042655 | Bacteria | 5777 |
| 87 | Ga0466706_036265 | 3300042599 | Bacteria | 1380 |
| 88 | Ga0466707_354973 | 3300042601 | Bacteria | 6540 |
| 89 | Ga0466713_051603 | 3300042602 | Bacteria | 1631 |
| 90 | Ga0466716_349846 | 3300042605 | Bacteria | 13854 |
| 91 | Ga0466722_108389 | 3300042609 | Bacteria | 5696 |
| 92 | 2227535714 | 2225789004 | Bacteria | 63282 |
| 93 | IMNBL1DRAFT_c0004546 | 3300000062 | Bacteria | 8290 |
| 94 | Ga0068305_10002668 | 3300005083 | Bacteria | 54496 |
| 95 | Ga0466711_048732 | 3300042615 | Bacteria | 11043 |
| 96 | Ga0466711_289315 | 3300042615 | Bacteria | 3474 |
| 97 | Ga0466715_077237 | 3300042616 | Bacteria | 28902 |
| 98 | Ga0466715_090521 | 3300042616 | Bacteria | 1597 |
| 99 | Ga0466715_283680 | 3300042616 | Bacteria | 3291 |
| 100 | Ga0466723_106108 | 3300042618 | Bacteria | 4562 |
| 101 | Ga0466726_048220 | 3300042619 | Unclassified | 2609 |
| 102 | Ga0466726_444667 | 3300042619 | Bacteria | 3488 |
| 103 | Ga0466728_405684 | 3300042620 | Unclassified | 3994 |
| 104 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 105 | Ga0466690_302558 | 3300042590 | Bacteria | 13388 |
| 106 | Ga0466692_157293 | 3300042591 | Bacteria | 55644 |
| 107 | Ga0466696_317252 | 3300042596 | Bacteria | 26380 |
| 108 | Ga0466735_100202 | 3300042624 | Bacteria | 2556 |
| 109 | Ga0466704_102976 | 3300042643 | Bacteria | 3716 |
| 110 | Ga0466706_116626 | 3300042599 | Bacteria | 1377 |
| 111 | Ga0466713_056121 | 3300042602 | Bacteria | 24333 |
| 112 | Ga0068302_10077873 | 3300005071 | Bacteria | 2450 |
| 113 | Ga0466711_057542 | 3300042615 | Bacteria | 70908 |
| 114 | Ga0466711_398346 | 3300042615 | Bacteria | 8484 |
| 115 | Ga0466715_277374 | 3300042616 | Bacteria | 35541 |
| 116 | Ga0466690_134341 | 3300042590 | Bacteria | 10830 |
| 117 | Ga0466692_175680 | 3300042591 | Bacteria | 3232 |
| 118 | Ga0466696_315666 | 3300042596 | Bacteria | 1325 |
| 119 | Ga0466696_379490 | 3300042596 | Bacteria | 2451 |
| 120 | Ga0466735_029393 | 3300042624 | Bacteria | 3601 |
| 121 | Ga0466735_167486 | 3300042624 | Bacteria | 3324 |
| 122 | Ga0466704_100895 | 3300042643 | Bacteria | 39526 |
| 123 | Ga0466706_104385 | 3300042599 | Bacteria | 22370 |
| 124 | Ga0466706_178083 | 3300042599 | Bacteria | 37293 |
| 125 | Ga0466707_237075 | 3300042601 | Bacteria | 1983 |
| 126 | Ga0466707_289818 | 3300042601 | Bacteria | 1205 |
| 127 | Ga0466719_143659 | 3300042606 | Bacteria | 4357 |
| 128 | Ga0466719_206082 | 3300042606 | Bacteria | 11762 |
| 129 | Ga0466722_068893 | 3300042609 | Bacteria | 40868 |
| 130 | Ga0466722_136436 | 3300042609 | Bacteria | 9717 |
| 131 | IMNBL1DRAFT_c0017376 | 3300000062 | Bacteria | 3030 |
| 132 | Ga0068305_10013648 | 3300005083 | Bacteria | 8744 |
| 133 | Ga0466715_101945 | 3300042616 | Bacteria | 16309 |
| 134 | Ga0466723_118562 | 3300042618 | Bacteria | 10951 |
| 135 | Ga0466726_475812 | 3300042619 | Bacteria | 1224 |
| 136 | Ga0466728_105795 | 3300042620 | Unclassified | 5159 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08534 | GO:0016491 | oxidoreductase activity | MF |
| PF10417 | GO:0051920 | peroxiredoxin activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.