Protein Family IF07167
Metagenome
Isolate
183
Members
56
Samples
159
Scaffolds
259.65
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_263151|Ga0466705_263151_11985_12848
- Length
- 287 aa
- Sequence
- MDMFLPPIRGTTPTVNKMADKMVNKTRRPAPMPILEFQNVSKIYNNTTTALTDVSFSVDEGEFVSIIGPSGSGKSTILRCVNRLVDATRGEIIFDGHDINRANKKELRQVRKKTGMIFQHYNLVDRLSVIENVLHGRLGHKHTLTGVVGYYTEKEKENAFQILAKLGLTEQAYKRCDELSGGQKQRVGIARSLMQEPRLILCDEPIASLDPSASKVIMDHLSVINKNMNLTCIFNLHQVDVALRYSKRIIGITLGKIVYDGPPDQLGKEKIHEIYQSSEGELITDVG
Sample Types
Isolate
13.1%
Metagenome
86.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Unclassified
34.5%
Kalotermitidae
14.5%
Drosophilidae
1.8%
Blattidae
1.8%
Formicidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 2 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 3 | 2820730639 | Unclassified Chloroflexi Th196P4bin31 | Isolate | Unclassified |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 20 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 21 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 22 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 28 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 31 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 32 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 33 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 34 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 35 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 36 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 37 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 40 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 47 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 51 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 52 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 53 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 54 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 55 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_141323 | 3300042612 | Bacteria | 2531 |
| 2 | Ga0466717_294713 | 3300042604 | Bacteria | 14698 |
| 3 | Ga0466693_232109 | 3300042592 | Bacteria | 1329 |
| 4 | Ga0466731_188477 | 3300042622 | Unclassified | 2953 |
| 5 | Ga0466731_215906 | 3300042622 | Bacteria | 5359 |
| 6 | Ga0466704_054820 | 3300042643 | Bacteria | 55164 |
| 7 | Ga0466704_324765 | 3300042643 | Bacteria | 62752 |
| 8 | Ga0466704_363684 | 3300042643 | Bacteria | 1082 |
| 9 | Ga0466715_070393 | 3300042616 | Bacteria | 2458 |
| 10 | Ga0466715_412341 | 3300042616 | Bacteria | 3301 |
| 11 | Ga0123356_10147683 | 3300010049 | Bacteria | 2329 |
| 12 | Ga0123356_11292146 | 3300010049 | Bacteria | 893 |
| 13 | Ga0123353_10067888 | 3300010167 | Bacteria | 5726 |
| 14 | Ga0123353_10122906 | 3300010167 | Bacteria | 4172 |
| 15 | Ga0123353_10141576 | 3300010167 | Bacteria | 3852 |
| 16 | Ga0123353_10180413 | 3300010167 | Bacteria | 3343 |
| 17 | Ga0123353_10347794 | 3300010167 | Bacteria | 2236 |
| 18 | Ga0123353_10510124 | 3300010167 | Bacteria | 1749 |
| 19 | Ga0123353_10558371 | 3300010167 | Bacteria | 1649 |
| 20 | Ga0123354_10270408 | 3300010882 | Bacteria | 1674 |
| 21 | Ga0466705_263151 | 3300042612 | Bacteria | 17422 |
| 22 | Ga0466716_073376 | 3300042605 | Bacteria | 13105 |
| 23 | Ga0466719_405934 | 3300042606 | Bacteria | 3428 |
| 24 | Ga0466721_225565 | 3300042608 | Bacteria | 2247 |
| 25 | Ga0466721_386937 | 3300042608 | Bacteria | 1100 |
| 26 | Ga0466699_106790 | 3300042597 | Bacteria | 2230 |
| 27 | JGI24702J35022_10006434 | 3300002462 | Bacteria | 6791 |
| 28 | JGI24699J35502_11094712 | 3300002509 | Bacteria | 2210 |
| 29 | Ga0466715_561820 | 3300042616 | Bacteria | 4024 |
| 30 | Ga0123356_10432386 | 3300010049 | Unclassified | 1461 |
| 31 | Ga0123356_10559187 | 3300010049 | Bacteria | 1306 |
| 32 | Ga0123356_11386476 | 3300010049 | Bacteria | 864 |
| 33 | Ga0123353_10028284 | 3300010167 | Bacteria | 8609 |
| 34 | Ga0123353_10096488 | 3300010167 | Bacteria | 4764 |
| 35 | Ga0123353_10182182 | 3300010167 | Bacteria | 3324 |
| 36 | Ga0123353_10274723 | 3300010167 | Bacteria | 2593 |
| 37 | Ga0123353_10348332 | 3300010167 | Bacteria | 2233 |
| 38 | Ga0466733_014292 | 3300042659 | Bacteria | 1759 |
| 39 | Ga0466717_282978 | 3300042604 | Bacteria | 2274 |
| 40 | Ga0466731_187002 | 3300042622 | Bacteria | 1466 |
| 41 | Ga0466731_373195 | 3300042622 | Bacteria | 1482 |
| 42 | AustNasuHG_c1015439 | 3300000089 | Bacteria | 2576 |
| 43 | JGI24705J35276_12236184 | 3300002504 | Bacteria | 7610 |
| 44 | Ga0466705_407864 | 3300042612 | Bacteria | 5139 |
| 45 | Ga0123355_10024506 | 3300009826 | Bacteria | 9701 |
| 46 | Ga0123355_10271258 | 3300009826 | Bacteria | 2357 |
| 47 | Ga0123355_10420061 | 3300009826 | Bacteria | 1709 |
| 48 | Ga0123355_10540986 | 3300009826 | Bacteria | 1414 |
| 49 | Ga0123356_10001761 | 3300010049 | Bacteria | 23598 |
| 50 | Ga0123356_10021927 | 3300010049 | Bacteria | 6031 |
| 51 | Ga0123356_10024193 | 3300010049 | Bacteria | 5716 |
| 52 | Ga0123353_10005951 | 3300010167 | Bacteria | 16137 |
| 53 | Ga0123353_10078584 | 3300010167 | Bacteria | 5302 |
| 54 | Ga0123353_10110928 | 3300010167 | Bacteria | 4419 |
| 55 | Ga0123353_10145305 | 3300010167 | Bacteria | 3793 |
| 56 | Ga0123353_10332557 | 3300010167 | Bacteria | 2298 |
| 57 | Ga0123353_10546804 | 3300010167 | Bacteria | 1671 |
| 58 | Ga0123353_10587497 | 3300010167 | Bacteria | 1596 |
| 59 | Ga0123353_11139765 | 3300010167 | Bacteria | 1031 |
| 60 | Ga0415639_093016 | 3300038395 | Bacteria | 2889 |
| 61 | Ga0466693_042001 | 3300042592 | Bacteria | 1390 |
| 62 | Ga0466691_074662 | 3300042593 | Bacteria | 47101 |
| 63 | Ga0466691_085788 | 3300042593 | Bacteria | 14058 |
| 64 | Ga0466704_148204 | 3300042643 | Bacteria | 2451 |
| 65 | JGI24695J34938_10000002 | 3300002450 | Bacteria | 261916 |
| 66 | JGI24702J35022_10002396 | 3300002462 | Bacteria | 11466 |
| 67 | JGI24705J35276_12228253 | 3300002504 | Bacteria | 3153 |
| 68 | Ga0072940_1044469 | 3300005200 | Bacteria | 1668 |
| 69 | Ga0466723_095346 | 3300042618 | Bacteria | 2784 |
| 70 | Ga0123355_10009755 | 3300009826 | Bacteria | 14637 |
| 71 | Ga0123356_10033343 | 3300010049 | Bacteria | 4815 |
| 72 | Ga0123356_10337274 | 3300010049 | Bacteria | 1627 |
| 73 | Ga0123356_10378347 | 3300010049 | Unclassified | 1548 |
| 74 | Ga0123356_10413185 | 3300010049 | Unclassified | 1489 |
| 75 | Ga0123353_10140044 | 3300010167 | Bacteria | 3876 |
| 76 | Ga0123353_10194523 | 3300010167 | Bacteria | 3198 |
| 77 | Ga0123353_10215787 | 3300010167 | Bacteria | 3005 |
| 78 | Ga0123353_10317294 | 3300010167 | Bacteria | 2367 |
| 79 | Ga0123353_10522117 | 3300010167 | Bacteria | 1722 |
| 80 | Ga0123354_10337517 | 3300010882 | Unclassified | 1363 |
| 81 | Ga0466721_243731 | 3300042608 | Bacteria | 1027 |
| 82 | Ga0466731_421936 | 3300042622 | Bacteria | 2797 |
| 83 | Ga0466704_470401 | 3300042643 | Bacteria | 3380 |
| 84 | JGI24703J35330_11740069 | 3300002501 | Bacteria | 3362 |
| 85 | Ga0123356_10014613 | 3300010049 | Bacteria | 7545 |
| 86 | Ga0123356_10116759 | 3300010049 | Bacteria | 2588 |
| 87 | Ga0123356_10128314 | 3300010049 | Bacteria | 2480 |
| 88 | Ga0123353_10153392 | 3300010167 | Bacteria | 3675 |
| 89 | Ga0123353_10368436 | 3300010167 | Bacteria | 2155 |
| 90 | Ga0123353_10677535 | 3300010167 | Bacteria | 1453 |
| 91 | Ga0123353_10998090 | 3300010167 | Bacteria | 1125 |
| 92 | Ga0123353_11198368 | 3300010167 | Bacteria | 997 |
| 93 | Ga0466717_002325 | 3300042604 | Bacteria | 10627 |
| 94 | Ga0466717_027948 | 3300042604 | Bacteria | 1595 |
| 95 | Ga0466717_205872 | 3300042604 | Bacteria | 1068 |
| 96 | Ga0466721_169122 | 3300042608 | Bacteria | 1538 |
| 97 | Ga0466694_010659 | 3300042594 | Bacteria | 5073 |
| 98 | Ga0466731_171252 | 3300042622 | Bacteria | 2380 |
| 99 | Ga0466702_087279 | 3300042635 | Bacteria | 5913 |
| 100 | Ga0123357_10002320 | 3300009784 | Bacteria | 21120 |
| 101 | Ga0123355_10041786 | 3300009826 | Bacteria | 7466 |
| 102 | Ga0123355_10366469 | 3300009826 | Unclassified | 1892 |
| 103 | Ga0123356_10497814 | 3300010049 | Bacteria | 1374 |
| 104 | Ga0123353_10017843 | 3300010167 | Bacteria | 10460 |
| 105 | Ga0123353_10102157 | 3300010167 | Bacteria | 4621 |
| 106 | Ga0123353_10140508 | 3300010167 | Bacteria | 3869 |
| 107 | Ga0123353_10152379 | 3300010167 | Bacteria | 3689 |
| 108 | Ga0123353_10301447 | 3300010167 | Bacteria | 2446 |
| 109 | Ga0123353_10441281 | 3300010167 | Bacteria | 1920 |
| 110 | Ga0123353_10460388 | 3300010167 | Bacteria | 1869 |
| 111 | Ga0123353_10479922 | 3300010167 | Bacteria | 1819 |
| 112 | Ga0123353_10512460 | 3300010167 | Bacteria | 1743 |
| 113 | Ga0123353_10967131 | 3300010167 | Bacteria | 1149 |
| 114 | Ga0415639_007810 | 3300038395 | Bacteria | 15574 |
| 115 | Ga0466691_100170 | 3300042593 | Bacteria | 6084 |
| 116 | Ga0466731_059144 | 3300042622 | Bacteria | 1572 |
| 117 | Ga0466731_164306 | 3300042622 | Bacteria | 1707 |
| 118 | IMNBL1DRAFT_c0000602 | 3300000062 | Bacteria | 28883 |
| 119 | JGI24705J35276_12162055 | 3300002504 | Bacteria | 1238 |
| 120 | JGI24705J35276_12234874 | 3300002504 | Bacteria | 5931 |
| 121 | Ga0072941_1163022 | 3300005201 | Unclassified | 12445 |
| 122 | Ga0466715_174751 | 3300042616 | Bacteria | 60972 |
| 123 | Ga0123355_10019326 | 3300009826 | Bacteria | 10845 |
| 124 | Ga0123355_10113196 | 3300009826 | Bacteria | 4233 |
| 125 | Ga0123355_10185268 | 3300009826 | Bacteria | 3080 |
| 126 | Ga0123356_10241780 | 3300010049 | Unclassified | 1877 |
| 127 | Ga0123356_10858082 | 3300010049 | Bacteria | 1079 |
| 128 | Ga0123353_10084927 | 3300010167 | Bacteria | 5097 |
| 129 | Ga0123353_10102155 | 3300010167 | Bacteria | 4621 |
| 130 | Ga0123353_10120719 | 3300010167 | Bacteria | 4214 |
| 131 | Ga0123353_10146048 | 3300010167 | Bacteria | 3782 |
| 132 | Ga0123353_10265434 | 3300010167 | Bacteria | 2649 |
| 133 | Ga0123353_10285082 | 3300010167 | Bacteria | 2533 |
| 134 | Ga0123353_10356784 | 3300010167 | Bacteria | 2199 |
| 135 | Ga0123353_10443623 | 3300010167 | Bacteria | 1913 |
| 136 | Ga0466721_097745 | 3300042608 | Bacteria | 1051 |
| 137 | Ga0415639_095027 | 3300038395 | Bacteria | 4146 |
| 138 | Ga0466691_117034 | 3300042593 | Unclassified | 4352 |
| 139 | Ga0466731_225672 | 3300042622 | Bacteria | 2814 |
| 140 | Ga0466731_281942 | 3300042622 | Bacteria | 1133 |
| 141 | Ga0466702_016903 | 3300042635 | Bacteria | 2901 |
| 142 | Ga0466708_077569 | 3300042652 | Bacteria | 21915 |
| 143 | JGI24702J35022_10000839 | 3300002462 | Bacteria | 18973 |
| 144 | Ga0123357_10000003 | 3300009784 | Bacteria | 349727 |
| 145 | Ga0466715_114824 | 3300042616 | Bacteria | 22706 |
| 146 | Ga0466718_108950 | 3300042617 | Bacteria | 1209 |
| 147 | Ga0466723_141933 | 3300042618 | Bacteria | 5426 |
| 148 | Ga0123355_10357111 | 3300009826 | Bacteria | 1929 |
| 149 | Ga0123356_10001141 | 3300010049 | Bacteria | 29354 |
| 150 | Ga0123356_10002695 | 3300010049 | Bacteria | 18857 |
| 151 | Ga0123356_10085195 | 3300010049 | Bacteria | 2996 |
| 152 | Ga0123356_10273008 | 3300010049 | Bacteria | 1781 |
| 153 | Ga0123353_10008124 | 3300010167 | Bacteria | 14290 |
| 154 | Ga0123353_10012829 | 3300010167 | Bacteria | 11948 |
| 155 | Ga0123353_10024871 | 3300010167 | Bacteria | 9107 |
| 156 | Ga0123353_10279799 | 3300010167 | Bacteria | 2563 |
| 157 | Ga0123353_10298752 | 3300010167 | Bacteria | 2460 |
| 158 | Ga0123353_10440117 | 3300010167 | Bacteria | 1923 |
| 159 | Ga0123353_10532094 | 3300010167 | Bacteria | 1701 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 51 | 207 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.