Protein Family IF07159
Metagenome
Isolate
172
Members
47
Samples
169
Scaffolds
208.91
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_246027|Ga0466705_246027_29415_30107
- Length
- 230 aa
- Sequence
- MDVVQKLKFPNNSILSGEHNFMDHLRQLIGRYPSLSGIADRIKDAVELLVHSFSSGGKLLLAGNGGSAADCEHIAGELMKGFMKKRPLPSGYLAELEKTSPECAAYLGPRLQGALPAIALTAHTGLSSACVNDIDGNIVFAQQVYGYGKTGDVFLGISTSGNAKNVVYAAAAARAKGLKTIALTGXXXXSLVKYADAAIIVPEKETYKVQELHLPVYHTLCLMLEEHFFP
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.9%
Kalotermitidae
32.6%
Unclassified
11.6%
Termopsidae
7.0%
Rhinotermitidae
4.7%
Hodotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
163
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 2 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 3 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_149421 | 3300042656 | Bacteria | 2381 |
| 2 | Ga0123355_11180347 | 3300009826 | Bacteria | 784 |
| 3 | Ga0123353_11043233 | 3300010167 | Bacteria | 1093 |
| 4 | Ga0123354_10171510 | 3300010882 | Bacteria | 2522 |
| 5 | JGI24700J35501_10930899 | 3300002508 | Bacteria | 36700 |
| 6 | Ga0466705_064912 | 3300042612 | Bacteria | 1424 |
| 7 | Ga0466712_106542 | 3300042614 | Bacteria | 17763 |
| 8 | Ga0466711_323775 | 3300042615 | Bacteria | 21849 |
| 9 | Ga0466715_067416 | 3300042616 | Bacteria | 21033 |
| 10 | Ga0466726_242039 | 3300042619 | Bacteria | 1461 |
| 11 | Ga0466726_374717 | 3300042619 | Bacteria | 1742 |
| 12 | Ga0466707_360495 | 3300042601 | Bacteria | 3727 |
| 13 | Ga0466722_213160 | 3300042609 | Bacteria | 9127 |
| 14 | Ga0466722_247175 | 3300042609 | Bacteria | 4151 |
| 15 | Ga0466690_116268 | 3300042590 | Bacteria | 3345 |
| 16 | Ga0466699_024907 | 3300042597 | Bacteria | 9502 |
| 17 | Ga0466699_064460 | 3300042597 | Bacteria | 2121 |
| 18 | Ga0466735_026334 | 3300042624 | Bacteria | 35147 |
| 19 | Ga0466704_031056 | 3300042643 | Bacteria | 7867 |
| 20 | Ga0466704_444548 | 3300042643 | Bacteria | 3563 |
| 21 | Ga0123355_10000659 | 3300009826 | Bacteria | 46817 |
| 22 | Ga0123356_10702094 | 3300010049 | Bacteria | 1181 |
| 23 | Ga0123353_10938450 | 3300010167 | Bacteria | 1172 |
| 24 | JGI24698J34947_10062270 | 3300002449 | Bacteria | 1832 |
| 25 | Ga0466705_048595 | 3300042612 | Bacteria | 7752 |
| 26 | Ga0466705_402630 | 3300042612 | Bacteria | 2110 |
| 27 | Ga0466712_182452 | 3300042614 | Bacteria | 2457 |
| 28 | Ga0466726_005779 | 3300042619 | Bacteria | 2539 |
| 29 | Ga0466726_202795 | 3300042619 | Bacteria | 3791 |
| 30 | Ga0466726_273750 | 3300042619 | Bacteria | 7228 |
| 31 | Ga0466728_114526 | 3300042620 | Bacteria | 3090 |
| 32 | Ga0466700_455540 | 3300042600 | Unclassified | 1542 |
| 33 | Ga0466720_028491 | 3300042607 | Bacteria | 76920 |
| 34 | Ga0466721_068204 | 3300042608 | Archaea | 2903 |
| 35 | Ga0466722_077248 | 3300042609 | Bacteria | 8746 |
| 36 | Ga0466722_096144 | 3300042609 | Bacteria | 6756 |
| 37 | Ga0264413_128292 | 3300024493 | Bacteria | 8444 |
| 38 | Ga0415639_105802 | 3300038395 | Bacteria | 7470 |
| 39 | Ga0466696_299174 | 3300042596 | Bacteria | 6503 |
| 40 | Ga0466699_118972 | 3300042597 | Bacteria | 29522 |
| 41 | Ga0466735_009612 | 3300042624 | Bacteria | 1919 |
| 42 | Ga0466703_308941 | 3300042636 | Bacteria | 13319 |
| 43 | Ga0466704_028901 | 3300042643 | Bacteria | 4515 |
| 44 | Ga0466727_245506 | 3300042655 | Bacteria | 1205 |
| 45 | Ga0123356_10020788 | 3300010049 | Bacteria | 6207 |
| 46 | Ga0123356_10033096 | 3300010049 | Unclassified | 4834 |
| 47 | Ga0123356_10160427 | 3300010049 | Bacteria | 2245 |
| 48 | Ga0123356_11865776 | 3300010049 | Bacteria | 748 |
| 49 | Ga0123353_10002456 | 3300010167 | Bacteria | 23052 |
| 50 | JGI24695J34938_10023103 | 3300002450 | Bacteria | 3003 |
| 51 | Ga0466705_422400 | 3300042612 | Bacteria | 19214 |
| 52 | Ga0466712_088504 | 3300042614 | Bacteria | 13276 |
| 53 | Ga0466712_115637 | 3300042614 | Bacteria | 1579 |
| 54 | Ga0466726_169482 | 3300042619 | Bacteria | 13014 |
| 55 | Ga0466726_240040 | 3300042619 | Bacteria | 5029 |
| 56 | Ga0466726_354312 | 3300042619 | Bacteria | 12493 |
| 57 | Ga0466706_252059 | 3300042599 | Bacteria | 1160 |
| 58 | Ga0466716_225749 | 3300042605 | Bacteria | 4590 |
| 59 | Ga0466719_121097 | 3300042606 | Bacteria | 3568 |
| 60 | Ga0466722_163181 | 3300042609 | Bacteria | 1190 |
| 61 | Ga0415639_157743 | 3300038395 | Bacteria | 5165 |
| 62 | Ga0466690_270511 | 3300042590 | Bacteria | 2984 |
| 63 | Ga0466694_152149 | 3300042594 | Bacteria | 1206 |
| 64 | Ga0466704_476491 | 3300042643 | Bacteria | 4678 |
| 65 | Ga0466704_573637 | 3300042643 | Bacteria | 7754 |
| 66 | Ga0466709_000526 | 3300042648 | Bacteria | 10476 |
| 67 | Ga0466732_337076 | 3300042656 | Bacteria | 1950 |
| 68 | Ga0123355_10025451 | 3300009826 | Bacteria | 9528 |
| 69 | Ga0123353_10021112 | 3300010167 | Bacteria | 9759 |
| 70 | JGI24698J34947_10000939 | 3300002449 | Bacteria | 14827 |
| 71 | JGI24698J34947_10001752 | 3300002449 | Bacteria | 11564 |
| 72 | JGI24698J34947_10031788 | 3300002449 | Bacteria | 2775 |
| 73 | JGI24702J35022_10193327 | 3300002462 | Bacteria | 1161 |
| 74 | Ga0466705_193071 | 3300042612 | Bacteria | 1301 |
| 75 | Ga0466712_136649 | 3300042614 | Bacteria | 51583 |
| 76 | Ga0466726_336130 | 3300042619 | Bacteria | 1236 |
| 77 | Ga0466706_060552 | 3300042599 | Bacteria | 2400 |
| 78 | Ga0466700_048910 | 3300042600 | Unclassified | 2288 |
| 79 | Ga0466700_161310 | 3300042600 | Bacteria | 1176 |
| 80 | Ga0466717_128414 | 3300042604 | Bacteria | 6630 |
| 81 | Ga0466719_224760 | 3300042606 | Bacteria | 8391 |
| 82 | Ga0466722_056847 | 3300042609 | Bacteria | 6664 |
| 83 | Ga0415639_196660 | 3300038395 | Bacteria | 1503 |
| 84 | Ga0466691_081883 | 3300042593 | Bacteria | 10345 |
| 85 | Ga0466694_071384 | 3300042594 | Bacteria | 50432 |
| 86 | Ga0466694_101978 | 3300042594 | Bacteria | 4818 |
| 87 | Ga0466694_118785 | 3300042594 | Bacteria | 2231 |
| 88 | Ga0466699_279088 | 3300042597 | Bacteria | 4268 |
| 89 | Ga0123356_10202821 | 3300010049 | Unclassified | 2025 |
| 90 | Ga0123353_10875029 | 3300010167 | Bacteria | 1227 |
| 91 | JGI24698J34947_10001546 | 3300002449 | Bacteria | 12174 |
| 92 | Ga0466705_074848 | 3300042612 | Bacteria | 1636 |
| 93 | Ga0466705_199419 | 3300042612 | Bacteria | 14487 |
| 94 | Ga0466715_441051 | 3300042616 | Bacteria | 1982 |
| 95 | Ga0466723_023955 | 3300042618 | Bacteria | 16255 |
| 96 | Ga0466723_087389 | 3300042618 | Bacteria | 4984 |
| 97 | Ga0466728_301858 | 3300042620 | Bacteria | 1005 |
| 98 | Ga0466707_358653 | 3300042601 | Bacteria | 1064 |
| 99 | Ga0466719_518488 | 3300042606 | Bacteria | 2841 |
| 100 | Ga0466720_003680 | 3300042607 | Bacteria | 4705 |
| 101 | Ga0466722_087072 | 3300042609 | Bacteria | 1887 |
| 102 | Ga0160452_100192 | 3300012834 | Bacteria | 68067 |
| 103 | Ga0264413_150823 | 3300024493 | Bacteria | 1653 |
| 104 | Ga0415639_105355 | 3300038395 | Bacteria | 3409 |
| 105 | Ga0466692_054732 | 3300042591 | Bacteria | 3143 |
| 106 | Ga0466691_058363 | 3300042593 | Bacteria | 17021 |
| 107 | Ga0466696_244846 | 3300042596 | Bacteria | 12317 |
| 108 | Ga0466735_154409 | 3300042624 | Bacteria | 5665 |
| 109 | Ga0466704_140178 | 3300042643 | Bacteria | 60046 |
| 110 | Ga0466704_511313 | 3300042643 | Bacteria | 19369 |
| 111 | Ga0466709_209657 | 3300042648 | Bacteria | 3084 |
| 112 | Ga0466727_174357 | 3300042655 | Unclassified | 1056 |
| 113 | Ga0466727_241199 | 3300042655 | Bacteria | 2109 |
| 114 | Ga0123355_10075322 | 3300009826 | Bacteria | 5402 |
| 115 | Ga0072941_1094286 | 3300005201 | Bacteria | 1541 |
| 116 | Ga0466705_224184 | 3300042612 | Bacteria | 17581 |
| 117 | Ga0466705_246027 | 3300042612 | Bacteria | 50897 |
| 118 | Ga0466705_286225 | 3300042612 | Bacteria | 6417 |
| 119 | Ga0466705_338389 | 3300042612 | Bacteria | 1634 |
| 120 | Ga0466711_223943 | 3300042615 | Bacteria | 11621 |
| 121 | Ga0466726_102382 | 3300042619 | Bacteria | 24037 |
| 122 | Ga0466716_258761 | 3300042605 | Unclassified | 1847 |
| 123 | Ga0466719_395252 | 3300042606 | Bacteria | 1834 |
| 124 | Ga0415639_128826 | 3300038395 | Unclassified | 1558 |
| 125 | Ga0466691_142574 | 3300042593 | Bacteria | 5951 |
| 126 | Ga0466696_375924 | 3300042596 | Bacteria | 1701 |
| 127 | Ga0466696_437721 | 3300042596 | Bacteria | 2197 |
| 128 | Ga0466699_150613 | 3300042597 | Bacteria | 11278 |
| 129 | Ga0123355_10048472 | 3300009826 | Bacteria | 6907 |
| 130 | Ga0123355_10095507 | 3300009826 | Bacteria | 4698 |
| 131 | Ga0123355_10113475 | 3300009826 | Bacteria | 4226 |
| 132 | Ga0123355_10164351 | 3300009826 | Bacteria | 3335 |
| 133 | Ga0123355_10242264 | 3300009826 | Bacteria | 2552 |
| 134 | Ga0123356_11306348 | 3300010049 | Bacteria | 888 |
| 135 | Ga0123353_10866426 | 3300010167 | Bacteria | 1235 |
| 136 | Ga0160466_100200 | 3300012809 | Bacteria | 44970 |
| 137 | Ga0068305_10038611 | 3300005083 | Bacteria | 8410 |
| 138 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 139 | Ga0466715_031227 | 3300042616 | Bacteria | 8719 |
| 140 | Ga0466715_052656 | 3300042616 | Bacteria | 4770 |
| 141 | Ga0466715_077177 | 3300042616 | Bacteria | 4146 |
| 142 | Ga0466715_177524 | 3300042616 | Bacteria | 29754 |
| 143 | Ga0466715_533574 | 3300042616 | Bacteria | 3965 |
| 144 | Ga0466718_125286 | 3300042617 | Bacteria | 7809 |
| 145 | Ga0466707_178384 | 3300042601 | Bacteria | 3105 |
| 146 | Ga0466707_356522 | 3300042601 | Bacteria | 1057 |
| 147 | Ga0466722_099575 | 3300042609 | Bacteria | 7990 |
| 148 | Ga0466690_178715 | 3300042590 | Unclassified | 1780 |
| 149 | Ga0466691_025139 | 3300042593 | Bacteria | 13400 |
| 150 | Ga0466703_060311 | 3300042636 | Bacteria | 7814 |
| 151 | Ga0466703_113663 | 3300042636 | Bacteria | 6581 |
| 152 | Ga0466704_134435 | 3300042643 | Bacteria | 44988 |
| 153 | Ga0466709_185006 | 3300042648 | Bacteria | 4066 |
| 154 | Ga0466708_141296 | 3300042652 | Bacteria | 14270 |
| 155 | Ga0466732_453409 | 3300042656 | Bacteria | 2499 |
| 156 | Ga0123356_10016090 | 3300010049 | Bacteria | 7148 |
| 157 | Ga0123356_10105279 | 3300010049 | Bacteria | 2714 |
| 158 | Ga0466712_124747 | 3300042614 | Bacteria | 9450 |
| 159 | Ga0466715_114435 | 3300042616 | Bacteria | 19834 |
| 160 | Ga0466715_347372 | 3300042616 | Bacteria | 2027 |
| 161 | Ga0466723_083829 | 3300042618 | Bacteria | 4617 |
| 162 | Ga0466726_280283 | 3300042619 | Bacteria | 15325 |
| 163 | Ga0466728_073664 | 3300042620 | Bacteria | 3661 |
| 164 | Ga0466707_114469 | 3300042601 | Bacteria | 1265 |
| 165 | Ga0466707_309398 | 3300042601 | Bacteria | 1178 |
| 166 | Ga0415639_122675 | 3300038395 | Bacteria | 2647 |
| 167 | Ga0466696_371914 | 3300042596 | Bacteria | 2092 |
| 168 | Ga0466699_344585 | 3300042597 | Bacteria | 1212 |
| 169 | Ga0466704_213253 | 3300042643 | Bacteria | 5122 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.