Protein Family IF07137
Metagenome
Isolate
142
Members
30
Samples
140
Scaffolds
431.89
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_191565|Ga0466705_191565_258_1667
- Length
- 469 aa
- Sequence
- LAKGRPRSFAGLYPGKAVSKTLVLETVSRYEKSMKLSLPYLDKTFPLEFPDENLLAVAEPNGCRAEGTAEELLAAALANPCGPAAGEDAFAGGQGGRNLAEFLRGGRRILVIINDATRPTPTEAILAALLPFCGETGLGDENLSLLVATGAHRAPTEPEYHQILGRFFERLRSRCFHHDARNDAMVDIGTTRNGTPMLLNKRLFEADRIIATGSVEPHYFAGFTGGRKAFLPGIAAYKTIEANHRQALSPSARSLVLEGNPVHEDMMDALPLIKAPVFSVMTVLDREQGVAAATVGDLMASFYKAVEAARNIFCVAVSSRADIVVSVAKFPMDIDLYQSQKAIDNGAVALKDGGTLILVSSCRDGIGDEAYAGLLAASSSPADAVRRIKEGYRLGYHKAAKMAEVSGRAAVRAVSELSEERLASLFIKKAASPQEALDEALAGAKAQGNPCPKILILPDGCVTVPDPGN
Sample Types
Isolate
1.4%
Metagenome
98.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
16.7%
Rhinotermitidae
10.0%
Unclassified
10.0%
Termopsidae
6.7%
Blaberidae
3.3%
Hodotermitidae
3.3%
Passalidae
3.3%
Taxonomy
Archaea
2
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 9 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_019242 | 3300042612 | Bacteria | 21181 |
| 2 | Ga0466705_050369 | 3300042612 | Bacteria | 2266 |
| 3 | Ga0466705_139624 | 3300042612 | Bacteria | 15712 |
| 4 | Ga0466711_003271 | 3300042615 | Bacteria | 13254 |
| 5 | Ga0466711_064077 | 3300042615 | Bacteria | 6310 |
| 6 | Ga0466723_008250 | 3300042618 | Bacteria | 3798 |
| 7 | Ga0466723_094175 | 3300042618 | Bacteria | 26461 |
| 8 | Ga0466723_369153 | 3300042618 | Bacteria | 2578 |
| 9 | Ga0466726_055570 | 3300042619 | Bacteria | 16834 |
| 10 | Ga0466726_268471 | 3300042619 | Bacteria | 3023 |
| 11 | Ga0466726_289011 | 3300042619 | Bacteria | 4985 |
| 12 | Ga0466690_159319 | 3300042590 | Unclassified | 3300 |
| 13 | Ga0466691_203490 | 3300042593 | Bacteria | 13335 |
| 14 | Ga0466696_163388 | 3300042596 | Bacteria | 17204 |
| 15 | Ga0466716_361468 | 3300042605 | Unclassified | 3461 |
| 16 | Ga0466704_119942 | 3300042643 | Bacteria | 6589 |
| 17 | Ga0466704_206246 | 3300042643 | Bacteria | 8444 |
| 18 | Ga0466709_228066 | 3300042648 | Bacteria | 2464 |
| 19 | Ga0466708_009451 | 3300042652 | Bacteria | 2260 |
| 20 | Ga0466708_126565 | 3300042652 | Bacteria | 8422 |
| 21 | Ga0466727_246309 | 3300042655 | Bacteria | 5013 |
| 22 | Ga0466705_016375 | 3300042612 | Bacteria | 4711 |
| 23 | Ga0466715_250697 | 3300042616 | Bacteria | 2808 |
| 24 | Ga0466723_058400 | 3300042618 | Bacteria | 1999 |
| 25 | Ga0466723_130141 | 3300042618 | Bacteria | 92926 |
| 26 | Ga0466692_116113 | 3300042591 | Bacteria | 19506 |
| 27 | Ga0466692_196387 | 3300042591 | Bacteria | 11129 |
| 28 | Ga0466691_031236 | 3300042593 | Unclassified | 5468 |
| 29 | Ga0466691_125507 | 3300042593 | Bacteria | 45141 |
| 30 | Ga0466694_052407 | 3300042594 | Bacteria | 7099 |
| 31 | Ga0466696_069087 | 3300042596 | Bacteria | 25119 |
| 32 | Ga0466706_217083 | 3300042599 | Bacteria | 2130 |
| 33 | Ga0466707_138313 | 3300042601 | Bacteria | 2589 |
| 34 | Ga0466707_212044 | 3300042601 | Bacteria | 1994 |
| 35 | Ga0466713_031870 | 3300042602 | Bacteria | 11150 |
| 36 | Ga0466713_137820 | 3300042602 | Bacteria | 1398 |
| 37 | Ga0466716_476600 | 3300042605 | Bacteria | 6196 |
| 38 | Ga0466719_354172 | 3300042606 | Bacteria | 12804 |
| 39 | Ga0466703_027439 | 3300042636 | Bacteria | 16930 |
| 40 | Ga0466703_262390 | 3300042636 | Unclassified | 4645 |
| 41 | Ga0466703_326444 | 3300042636 | Bacteria | 8206 |
| 42 | Ga0466704_307092 | 3300042643 | Bacteria | 10668 |
| 43 | Ga0466704_608530 | 3300042643 | Bacteria | 1836 |
| 44 | Ga0466709_227510 | 3300042648 | Bacteria | 7151 |
| 45 | Ga0466727_010807 | 3300042655 | Bacteria | 4108 |
| 46 | Ga0466727_166284 | 3300042655 | Bacteria | 5524 |
| 47 | Ga0466727_279366 | 3300042655 | Bacteria | 2135 |
| 48 | Ga0123356_10219056 | 3300010049 | Bacteria | 1958 |
| 49 | Ga0123353_10194465 | 3300010167 | Bacteria | 3198 |
| 50 | Ga0466723_024654 | 3300042618 | Bacteria | 62216 |
| 51 | Ga0466726_108273 | 3300042619 | Bacteria | 13843 |
| 52 | Ga0466726_135338 | 3300042619 | Archaea | 30072 |
| 53 | Ga0466690_199920 | 3300042590 | Bacteria | 33657 |
| 54 | Ga0466696_041305 | 3300042596 | Bacteria | 3471 |
| 55 | Ga0466707_069013 | 3300042601 | Bacteria | 2878 |
| 56 | Ga0466707_380152 | 3300042601 | Bacteria | 1491 |
| 57 | Ga0466717_300272 | 3300042604 | Bacteria | 1677 |
| 58 | Ga0466703_129212 | 3300042636 | Bacteria | 1417 |
| 59 | Ga0466704_115199 | 3300042643 | Bacteria | 2346 |
| 60 | Ga0466709_055984 | 3300042648 | Bacteria | 9319 |
| 61 | Ga0466732_250046 | 3300042656 | Bacteria | 1796 |
| 62 | Ga0466711_329226 | 3300042615 | Bacteria | 4394 |
| 63 | Ga0466723_199246 | 3300042618 | Bacteria | 10191 |
| 64 | Ga0466726_016913 | 3300042619 | Bacteria | 10019 |
| 65 | Ga0466729_176292 | 3300042621 | Archaea | 11324 |
| 66 | Ga0466690_014261 | 3300042590 | Bacteria | 9116 |
| 67 | Ga0466690_041393 | 3300042590 | Bacteria | 11324 |
| 68 | Ga0466692_134818 | 3300042591 | Bacteria | 5461 |
| 69 | Ga0466691_034417 | 3300042593 | Bacteria | 20665 |
| 70 | Ga0466694_012601 | 3300042594 | Bacteria | 4678 |
| 71 | Ga0466694_109991 | 3300042594 | Bacteria | 8877 |
| 72 | Ga0466696_440317 | 3300042596 | Bacteria | 4290 |
| 73 | Ga0466706_098895 | 3300042599 | Bacteria | 1924 |
| 74 | Ga0466716_110839 | 3300042605 | Bacteria | 4392 |
| 75 | Ga0466719_074290 | 3300042606 | Bacteria | 9579 |
| 76 | Ga0466729_274794 | 3300042621 | Bacteria | 1435 |
| 77 | Ga0466709_271065 | 3300042648 | Unclassified | 3764 |
| 78 | Ga0466708_013265 | 3300042652 | Bacteria | 2467 |
| 79 | Ga0466708_138933 | 3300042652 | Bacteria | 4541 |
| 80 | Ga0466727_077722 | 3300042655 | Bacteria | 8497 |
| 81 | Ga0466727_223492 | 3300042655 | Bacteria | 12270 |
| 82 | Ga0466705_143636 | 3300042612 | Bacteria | 2582 |
| 83 | Ga0466705_191565 | 3300042612 | Bacteria | 4711 |
| 84 | Ga0466715_353089 | 3300042616 | Bacteria | 11135 |
| 85 | Ga0466723_151180 | 3300042618 | Bacteria | 44562 |
| 86 | Ga0466691_098671 | 3300042593 | Bacteria | 24875 |
| 87 | Ga0466691_122659 | 3300042593 | Bacteria | 4809 |
| 88 | Ga0466722_065377 | 3300042609 | Bacteria | 7249 |
| 89 | Ga0466708_131211 | 3300042652 | Bacteria | 2405 |
| 90 | Ga0466708_313988 | 3300042652 | Bacteria | 3092 |
| 91 | Ga0466715_127539 | 3300042616 | Bacteria | 1960 |
| 92 | Ga0466715_127815 | 3300042616 | Bacteria | 21986 |
| 93 | Ga0466715_143987 | 3300042616 | Bacteria | 4723 |
| 94 | Ga0466715_398122 | 3300042616 | Bacteria | 4292 |
| 95 | Ga0466723_003023 | 3300042618 | Bacteria | 23764 |
| 96 | Ga0466723_136160 | 3300042618 | Bacteria | 19443 |
| 97 | Ga0466726_268325 | 3300042619 | Bacteria | 5041 |
| 98 | Ga0466726_342861 | 3300042619 | Bacteria | 3757 |
| 99 | Ga0466728_052105 | 3300042620 | Bacteria | 6715 |
| 100 | Ga0466728_117978 | 3300042620 | Bacteria | 3136 |
| 101 | Ga0466706_018280 | 3300042599 | Bacteria | 1568 |
| 102 | Ga0466716_074438 | 3300042605 | Bacteria | 33435 |
| 103 | Ga0466719_381492 | 3300042606 | Bacteria | 19334 |
| 104 | Ga0466709_395350 | 3300042648 | Bacteria | 2850 |
| 105 | Ga0466708_023223 | 3300042652 | Bacteria | 3901 |
| 106 | Ga0466708_212539 | 3300042652 | Bacteria | 5006 |
| 107 | Ga0466705_113128 | 3300042612 | Bacteria | 3891 |
| 108 | Ga0466715_127631 | 3300042616 | Bacteria | 2011 |
| 109 | Ga0466723_024653 | 3300042618 | Bacteria | 7383 |
| 110 | Ga0466723_071185 | 3300042618 | Bacteria | 53854 |
| 111 | Ga0466723_072105 | 3300042618 | Bacteria | 5800 |
| 112 | Ga0466726_036486 | 3300042619 | Bacteria | 2620 |
| 113 | Ga0466728_316150 | 3300042620 | Bacteria | 3788 |
| 114 | Ga0466694_016639 | 3300042594 | Bacteria | 1501 |
| 115 | Ga0466707_053790 | 3300042601 | Bacteria | 3261 |
| 116 | Ga0466716_241597 | 3300042605 | Bacteria | 15339 |
| 117 | Ga0466719_551557 | 3300042606 | Bacteria | 3391 |
| 118 | Ga0466722_101044 | 3300042609 | Bacteria | 26620 |
| 119 | IMNBL1DRAFT_c0001472 | 3300000062 | Bacteria | 17601 |
| 120 | Ga0466729_262809 | 3300042621 | Bacteria | 2869 |
| 121 | Ga0466703_102834 | 3300042636 | Bacteria | 50101 |
| 122 | Ga0466704_196215 | 3300042643 | Bacteria | 2518 |
| 123 | Ga0466709_224306 | 3300042648 | Bacteria | 5102 |
| 124 | Ga0466708_071796 | 3300042652 | Bacteria | 29991 |
| 125 | Ga0466708_080723 | 3300042652 | Bacteria | 29464 |
| 126 | Ga0466715_013771 | 3300042616 | Bacteria | 2023 |
| 127 | Ga0466715_053438 | 3300042616 | Unclassified | 15686 |
| 128 | Ga0466723_033439 | 3300042618 | Bacteria | 9848 |
| 129 | Ga0466728_063894 | 3300042620 | Bacteria | 1522 |
| 130 | Ga0466728_391040 | 3300042620 | Bacteria | 2459 |
| 131 | Ga0466694_403777 | 3300042594 | Bacteria | 1879 |
| 132 | Ga0466696_363343 | 3300042596 | Bacteria | 7948 |
| 133 | Ga0466696_410401 | 3300042596 | Bacteria | 4534 |
| 134 | Ga0466716_001020 | 3300042605 | Bacteria | 3882 |
| 135 | Ga0466722_077861 | 3300042609 | Bacteria | 2876 |
| 136 | Ga0466729_270775 | 3300042621 | Bacteria | 2511 |
| 137 | Ga0466703_129785 | 3300042636 | Bacteria | 1973 |
| 138 | Ga0466703_231641 | 3300042636 | Bacteria | 5191 |
| 139 | Ga0466704_449099 | 3300042643 | Bacteria | 67975 |
| 140 | Ga0466708_069635 | 3300042652 | Bacteria | 9335 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF09861 | GO:0050043 | lactate racemase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.