Protein Family IF07117
Metagenome
Isolate
125
Members
43
Samples
120
Scaffolds
363.14
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_151782|Ga0466705_151782_5138_6217
- Length
- 359 aa
- Sequence
- MAKKLKYGIVGCGGIANQKHLPAIENLEDAEAVAFCDIIGGRAEKANCXXXXGKGKVFTDYHELIKEDLDAVFVLTPNISHAEISIAALLAGKHVLCEKPMAKNYAEARRMIEARDKSGKLLTIGYQNRYRPDSLFLKAECEAGTLGEIYFAKATALRRRAVPTWGVFLDEEKQGGGPLIDIGTHALDLTLFMMNNYEPAYAVGTTYHKLNNDRKTGNAWGDWDPKKFTVEDSAFGFIVMKNGATIILQSSWALNTTEVREAVTTLSGTKAGADMPQAGNLVINGVKNGRQYTLCPAEGGAAAFYEGEAVKDTDLEAQTFAKAIRGKGKLYVLPEEAAAVTQILEGIYDSARTGKPHYF
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.5%
Kalotermitidae
32.6%
Unclassified
14.0%
Rhinotermitidae
7.0%
Termopsidae
7.0%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 42 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_318973 | 3300042612 | Bacteria | 1269 |
| 2 | Ga0466714_073680 | 3300042603 | Bacteria | 1375 |
| 3 | Ga0466719_193960 | 3300042606 | Bacteria | 6381 |
| 4 | Ga0123356_10139890 | 3300010049 | Bacteria | 2386 |
| 5 | Ga0123353_10138928 | 3300010167 | Bacteria | 3894 |
| 6 | Ga0466694_133168 | 3300042594 | Bacteria | 3431 |
| 7 | Ga0466695_091046 | 3300042595 | Bacteria | 29831 |
| 8 | Ga0466696_109333 | 3300042596 | Bacteria | 10792 |
| 9 | Ga0466703_303456 | 3300042636 | Bacteria | 2297 |
| 10 | Ga0466704_021438 | 3300042643 | Bacteria | 7057 |
| 11 | Ga0466704_364273 | 3300042643 | Unclassified | 3429 |
| 12 | Ga0466709_308220 | 3300042648 | Bacteria | 3370 |
| 13 | Ga0466708_045897 | 3300042652 | Bacteria | 8448 |
| 14 | Ga0466711_076850 | 3300042615 | Bacteria | 18451 |
| 15 | Ga0466723_114626 | 3300042618 | Bacteria | 2402 |
| 16 | Ga0466723_293236 | 3300042618 | Bacteria | 4391 |
| 17 | Ga0466728_057071 | 3300042620 | Unclassified | 3369 |
| 18 | Ga0466720_192118 | 3300042607 | Bacteria | 6634 |
| 19 | Ga0456237_0000854 | 3300041968 | Bacteria | 4771 |
| 20 | Ga0466690_270102 | 3300042590 | Bacteria | 9900 |
| 21 | Ga0466691_144617 | 3300042593 | Bacteria | 39257 |
| 22 | JGI24698J34947_10007461 | 3300002449 | Bacteria | 6013 |
| 23 | JGI24698J34947_10055622 | 3300002449 | Bacteria | 1970 |
| 24 | Ga0466735_002227 | 3300042624 | Bacteria | 3152 |
| 25 | Ga0466704_022270 | 3300042643 | Bacteria | 36377 |
| 26 | Ga0466709_153461 | 3300042648 | Bacteria | 6823 |
| 27 | Ga0466709_223252 | 3300042648 | Bacteria | 9527 |
| 28 | Ga0466708_055266 | 3300042652 | Bacteria | 3400 |
| 29 | Ga0466708_446999 | 3300042652 | Bacteria | 48325 |
| 30 | Ga0466725_397271 | 3300042654 | Bacteria | 1578 |
| 31 | Ga0466727_029385 | 3300042655 | Bacteria | 2643 |
| 32 | Ga0466727_112586 | 3300042655 | Bacteria | 2064 |
| 33 | Ga0466727_303256 | 3300042655 | Bacteria | 8090 |
| 34 | Ga0466715_390359 | 3300042616 | Bacteria | 8457 |
| 35 | Ga0466715_607778 | 3300042616 | Bacteria | 1657 |
| 36 | Ga0466728_151142 | 3300042620 | Bacteria | 6083 |
| 37 | Ga0466707_253234 | 3300042601 | Bacteria | 4264 |
| 38 | Ga0466716_129169 | 3300042605 | Bacteria | 4946 |
| 39 | Ga0466690_345504 | 3300042590 | Bacteria | 2865 |
| 40 | Ga0466692_132086 | 3300042591 | Bacteria | 32476 |
| 41 | Ga0466696_070208 | 3300042596 | Bacteria | 11737 |
| 42 | JGI24698J34947_10009017 | 3300002449 | Bacteria | 5471 |
| 43 | Ga0466703_208520 | 3300042636 | Bacteria | 6621 |
| 44 | Ga0466703_339769 | 3300042636 | Bacteria | 2715 |
| 45 | Ga0466704_069846 | 3300042643 | Bacteria | 1851 |
| 46 | Ga0466704_082557 | 3300042643 | Bacteria | 9542 |
| 47 | Ga0466708_013131 | 3300042652 | Bacteria | 1994 |
| 48 | Ga0466715_419155 | 3300042616 | Unclassified | 1471 |
| 49 | Ga0466723_289349 | 3300042618 | Bacteria | 8898 |
| 50 | Ga0466728_050106 | 3300042620 | Bacteria | 3046 |
| 51 | Ga0466719_011642 | 3300042606 | Unclassified | 2770 |
| 52 | Ga0123355_10006539 | 3300009826 | Bacteria | 17290 |
| 53 | Ga0466691_011304 | 3300042593 | Bacteria | 11948 |
| 54 | Ga0466691_026806 | 3300042593 | Bacteria | 3248 |
| 55 | Ga0466699_355479 | 3300042597 | Bacteria | 12545 |
| 56 | JGI24698J34947_10044116 | 3300002449 | Bacteria | 2284 |
| 57 | Ga0072940_1077466 | 3300005200 | Bacteria | 1647 |
| 58 | Ga0466703_046056 | 3300042636 | Bacteria | 73078 |
| 59 | Ga0466703_410070 | 3300042636 | Bacteria | 17528 |
| 60 | Ga0466712_075474 | 3300042614 | Bacteria | 15530 |
| 61 | Ga0466712_314489 | 3300042614 | Bacteria | 1336 |
| 62 | Ga0466715_302450 | 3300042616 | Bacteria | 16043 |
| 63 | Ga0466718_139937 | 3300042617 | Bacteria | 1546 |
| 64 | Ga0466728_046484 | 3300042620 | Bacteria | 3338 |
| 65 | Ga0466705_304222 | 3300042612 | Bacteria | 5795 |
| 66 | Ga0466705_322083 | 3300042612 | Bacteria | 10764 |
| 67 | Ga0466719_429407 | 3300042606 | Bacteria | 11443 |
| 68 | Ga0456237_0001955 | 3300041968 | Unclassified | 3327 |
| 69 | Ga0466696_383846 | 3300042596 | Bacteria | 9892 |
| 70 | Ga0466699_026236 | 3300042597 | Bacteria | 10957 |
| 71 | Ga0466699_045408 | 3300042597 | Bacteria | 10959 |
| 72 | Ga0466699_069438 | 3300042597 | Bacteria | 2336 |
| 73 | JGI24705J35276_12224569 | 3300002504 | Bacteria | 2624 |
| 74 | Ga0466704_077196 | 3300042643 | Bacteria | 4229 |
| 75 | Ga0466704_233283 | 3300042643 | Bacteria | 14308 |
| 76 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 77 | Ga0466712_170844 | 3300042614 | Bacteria | 1660 |
| 78 | Ga0466712_286036 | 3300042614 | Bacteria | 6741 |
| 79 | Ga0466705_151782 | 3300042612 | Bacteria | 9022 |
| 80 | Ga0466700_311286 | 3300042600 | Bacteria | 2570 |
| 81 | Ga0466707_022953 | 3300042601 | Bacteria | 3138 |
| 82 | Ga0466707_418959 | 3300042601 | Bacteria | 1769 |
| 83 | Ga0466721_081037 | 3300042608 | Bacteria | 36334 |
| 84 | Ga0123353_10298296 | 3300010167 | Bacteria | 2462 |
| 85 | Ga0123353_10345323 | 3300010167 | Bacteria | 2246 |
| 86 | Ga0466690_383445 | 3300042590 | Bacteria | 3571 |
| 87 | Ga0466691_025653 | 3300042593 | Bacteria | 20181 |
| 88 | Ga0466699_111437 | 3300042597 | Bacteria | 1971 |
| 89 | Ga0466699_369003 | 3300042597 | Bacteria | 6372 |
| 90 | JGI24698J34947_10024386 | 3300002449 | Bacteria | 3230 |
| 91 | Ga0466704_071055 | 3300042643 | Bacteria | 2646 |
| 92 | Ga0466709_130890 | 3300042648 | Bacteria | 2703 |
| 93 | Ga0466712_050349 | 3300042614 | Bacteria | 10192 |
| 94 | Ga0466712_244462 | 3300042614 | Bacteria | 26322 |
| 95 | Ga0466718_108109 | 3300042617 | Bacteria | 4699 |
| 96 | Ga0466726_485593 | 3300042619 | Bacteria | 5586 |
| 97 | Ga0466705_176925 | 3300042612 | Bacteria | 5653 |
| 98 | Ga0466716_196903 | 3300042605 | Bacteria | 6995 |
| 99 | Ga0466694_267089 | 3300042594 | Bacteria | 1712 |
| 100 | Ga0466696_486635 | 3300042596 | Bacteria | 3281 |
| 101 | JGI24698J34947_10004735 | 3300002449 | Bacteria | 7431 |
| 102 | JGI24702J35022_10029784 | 3300002462 | Bacteria | 2929 |
| 103 | Ga0466708_041861 | 3300042652 | Unclassified | 8972 |
| 104 | Ga0466727_179643 | 3300042655 | Bacteria | 5241 |
| 105 | Ga0466712_052399 | 3300042614 | Bacteria | 3024 |
| 106 | Ga0466711_040847 | 3300042615 | Bacteria | 5689 |
| 107 | Ga0466718_025999 | 3300042617 | Bacteria | 10564 |
| 108 | Ga0466723_182671 | 3300042618 | Bacteria | 13117 |
| 109 | Ga0466705_234552 | 3300042612 | Bacteria | 14491 |
| 110 | Ga0466716_400549 | 3300042605 | Bacteria | 1623 |
| 111 | Ga0123355_10003919 | 3300009826 | Bacteria | 21530 |
| 112 | Ga0466692_143467 | 3300042591 | Bacteria | 1642 |
| 113 | JGI24698J34947_10000035 | 3300002449 | Bacteria | 37551 |
| 114 | Ga0466729_279458 | 3300042621 | Bacteria | 1502 |
| 115 | Ga0466703_179769 | 3300042636 | Unclassified | 7598 |
| 116 | Ga0466703_250503 | 3300042636 | Unclassified | 8844 |
| 117 | Ga0466709_158851 | 3300042648 | Bacteria | 5479 |
| 118 | Ga0466708_121173 | 3300042652 | Bacteria | 5993 |
| 119 | Ga0466723_146170 | 3300042618 | Bacteria | 9300 |
| 120 | Ga0466728_249752 | 3300042620 | Bacteria | 11343 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.