Protein Family IF07070
Metagenome
Isolate
165
Members
46
Samples
157
Scaffolds
384.61
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_061419|Ga0466705_061419_203_1471
- Length
- 422 aa
- Sequence
- MQYRNYGKSGFEVSALGLGCMRLPRLSTEGAASAEVDREKAYEIIRYAADHGVNYFDTAYGYHNRTSEEVLGEALEGGRREKVKIVTKQPFPVMADLKSGGGKTILENTRRNLENTLKKLRTSYLDVYLIHNIQISTWKDIKENKILEEYEKFRAEGLIRAIGFSYHGKFPCFKEVLESYDWDMCQIQQNLLDIHHEATAEGMKLAGKKGCALVIMEPLRGGGLAVPPPAVSAVYNEYPVKRSAVEWAFRHLLDYPEVSTILSGITTMEQLKEDIEIFSKPDAVPNCLSGDEKELIARVRAAYESLVSIPCTACEYCLPCPKGVNIPGVFSRFNEGAMFGNYTQSRRSYLFMTRSGQDASRCAAXXXXEKKCPQHIGIIEKLKAAHEVLKGWIEKRSVPEMRPNFQKKIFVMLKYRDLRGNN
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
30.4%
Termitidae
30.4%
Unclassified
21.7%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Hodotermitidae
2.2%
Blaberidae
2.2%
Taxonomy
Archaea
2
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 25 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 26 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 33 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_383579 | 3300042612 | Bacteria | 1743 |
| 2 | Ga0466711_435611 | 3300042615 | Bacteria | 1690 |
| 3 | Ga0466715_036616 | 3300042616 | Bacteria | 7581 |
| 4 | Ga0466715_476159 | 3300042616 | Unclassified | 5112 |
| 5 | Ga0466718_087149 | 3300042617 | Bacteria | 122153 |
| 6 | Ga0466723_192400 | 3300042618 | Bacteria | 2442 |
| 7 | Ga0466728_225923 | 3300042620 | Bacteria | 8188 |
| 8 | Ga0466728_280440 | 3300042620 | Bacteria | 3007 |
| 9 | Ga0466716_019262 | 3300042605 | Bacteria | 2154 |
| 10 | Ga0466722_094748 | 3300042609 | Bacteria | 17006 |
| 11 | Ga0466722_214480 | 3300042609 | Bacteria | 10750 |
| 12 | Ga0466722_214520 | 3300042609 | Bacteria | 1555 |
| 13 | Ga0466690_092341 | 3300042590 | Bacteria | 2964 |
| 14 | Ga0123353_10513910 | 3300010167 | Unclassified | 1740 |
| 15 | Ga0123353_10622161 | 3300010167 | Unclassified | 1537 |
| 16 | JGI24698J34947_10004258 | 3300002449 | Bacteria | 7784 |
| 17 | Ga0466703_047869 | 3300042636 | Bacteria | 58815 |
| 18 | Ga0466703_256814 | 3300042636 | Bacteria | 1487 |
| 19 | Ga0466708_069025 | 3300042652 | Bacteria | 81565 |
| 20 | Ga0466715_109543 | 3300042616 | Bacteria | 10136 |
| 21 | Ga0466715_176089 | 3300042616 | Bacteria | 6006 |
| 22 | Ga0466723_032252 | 3300042618 | Bacteria | 9635 |
| 23 | Ga0466723_179425 | 3300042618 | Bacteria | 7519 |
| 24 | Ga0466726_002893 | 3300042619 | Bacteria | 6860 |
| 25 | Ga0466700_142770 | 3300042600 | Bacteria | 3248 |
| 26 | Ga0466707_034853 | 3300042601 | Bacteria | 1586 |
| 27 | Ga0466707_374457 | 3300042601 | Bacteria | 1262 |
| 28 | Ga0466716_523626 | 3300042605 | Bacteria | 4022 |
| 29 | Ga0466719_176218 | 3300042606 | Bacteria | 3497 |
| 30 | Ga0123356_10001910 | 3300010049 | Bacteria | 22568 |
| 31 | JGI24702J35022_10020651 | 3300002462 | Bacteria | 3574 |
| 32 | Ga0466704_143499 | 3300042643 | Bacteria | 2501 |
| 33 | Ga0466704_361283 | 3300042643 | Bacteria | 18659 |
| 34 | Ga0466727_166351 | 3300042655 | Bacteria | 1792 |
| 35 | Ga0466705_213648 | 3300042612 | Bacteria | 21031 |
| 36 | Ga0466705_245926 | 3300042612 | Bacteria | 20777 |
| 37 | Ga0466705_319140 | 3300042612 | Bacteria | 1676 |
| 38 | Ga0466726_034522 | 3300042619 | Bacteria | 6769 |
| 39 | Ga0466726_133516 | 3300042619 | Bacteria | 8486 |
| 40 | Ga0466726_188118 | 3300042619 | Bacteria | 11542 |
| 41 | Ga0466726_443730 | 3300042619 | Bacteria | 4524 |
| 42 | Ga0466729_069420 | 3300042621 | Bacteria | 5933 |
| 43 | Ga0466706_128399 | 3300042599 | Bacteria | 4282 |
| 44 | Ga0466690_190938 | 3300042590 | Bacteria | 6052 |
| 45 | Ga0466690_374094 | 3300042590 | Bacteria | 5693 |
| 46 | Ga0466692_022074 | 3300042591 | Archaea | 2990 |
| 47 | Ga0466691_196363 | 3300042593 | Bacteria | 1652 |
| 48 | Ga0466699_309471 | 3300042597 | Bacteria | 3997 |
| 49 | Ga0123353_10109031 | 3300010167 | Bacteria | 4461 |
| 50 | Ga0123353_10314782 | 3300010167 | Archaea | 2379 |
| 51 | JGI24702J35022_10015184 | 3300002462 | Bacteria | 4241 |
| 52 | JGI24702J35022_10017041 | 3300002462 | Bacteria | 3976 |
| 53 | Ga0068305_10609974 | 3300005083 | Bacteria | 4716 |
| 54 | Ga0466703_131763 | 3300042636 | Bacteria | 2751 |
| 55 | Ga0466727_288283 | 3300042655 | Bacteria | 1570 |
| 56 | Ga0466727_327552 | 3300042655 | Bacteria | 2043 |
| 57 | Ga0466705_143120 | 3300042612 | Bacteria | 12823 |
| 58 | Ga0466705_451117 | 3300042612 | Bacteria | 4965 |
| 59 | Ga0466711_002521 | 3300042615 | Bacteria | 7076 |
| 60 | Ga0466723_247202 | 3300042618 | Bacteria | 2335 |
| 61 | Ga0466723_372164 | 3300042618 | Bacteria | 2718 |
| 62 | Ga0466728_237173 | 3300042620 | Bacteria | 2336 |
| 63 | Ga0466729_105599 | 3300042621 | Bacteria | 1762 |
| 64 | Ga0466722_173116 | 3300042609 | Bacteria | 181242 |
| 65 | Ga0466722_246924 | 3300042609 | Bacteria | 5230 |
| 66 | Ga0466690_258112 | 3300042590 | Bacteria | 5554 |
| 67 | Ga0466691_000578 | 3300042593 | Bacteria | 5284 |
| 68 | Ga0466696_467536 | 3300042596 | Bacteria | 9719 |
| 69 | Ga0466699_255361 | 3300042597 | Bacteria | 5069 |
| 70 | Ga0123357_10055018 | 3300009784 | Bacteria | 5361 |
| 71 | Ga0123355_10334292 | 3300009826 | Bacteria | 2025 |
| 72 | Ga0466703_316437 | 3300042636 | Bacteria | 17841 |
| 73 | Ga0466704_327973 | 3300042643 | Bacteria | 5179 |
| 74 | Ga0466704_426846 | 3300042643 | Unclassified | 1717 |
| 75 | Ga0466727_100764 | 3300042655 | Bacteria | 5576 |
| 76 | Ga0466727_119834 | 3300042655 | Bacteria | 1606 |
| 77 | Ga0466705_027842 | 3300042612 | Bacteria | 1704 |
| 78 | Ga0466705_061419 | 3300042612 | Bacteria | 2513 |
| 79 | Ga0466705_235936 | 3300042612 | Bacteria | 4292 |
| 80 | Ga0466712_021390 | 3300042614 | Unclassified | 3519 |
| 81 | Ga0466711_013535 | 3300042615 | Bacteria | 12075 |
| 82 | Ga0466711_091584 | 3300042615 | Bacteria | 27785 |
| 83 | Ga0466711_135017 | 3300042615 | Bacteria | 3583 |
| 84 | Ga0466723_151788 | 3300042618 | Bacteria | 2837 |
| 85 | Ga0466723_258430 | 3300042618 | Bacteria | 4220 |
| 86 | Ga0466706_176256 | 3300042599 | Bacteria | 7973 |
| 87 | Ga0466719_347256 | 3300042606 | Bacteria | 5089 |
| 88 | Ga0123357_10022095 | 3300009784 | Bacteria | 8526 |
| 89 | Ga0123354_10030050 | 3300010882 | Bacteria | 8538 |
| 90 | JGI24702J35022_10001722 | 3300002462 | Bacteria | 13558 |
| 91 | JGI24700J35501_10929348 | 3300002508 | Bacteria | 9091 |
| 92 | Ga0466704_391960 | 3300042643 | Bacteria | 1837 |
| 93 | Ga0466704_518089 | 3300042643 | Bacteria | 4351 |
| 94 | Ga0466709_075852 | 3300042648 | Bacteria | 8352 |
| 95 | Ga0466709_128020 | 3300042648 | Unclassified | 8540 |
| 96 | Ga0466708_179630 | 3300042652 | Bacteria | 5613 |
| 97 | Ga0466727_061511 | 3300042655 | Bacteria | 10322 |
| 98 | Ga0466727_152695 | 3300042655 | Bacteria | 1725 |
| 99 | Ga0466705_095473 | 3300042612 | Bacteria | 6967 |
| 100 | Ga0466710_011847 | 3300042613 | Bacteria | 1351 |
| 101 | Ga0466711_502192 | 3300042615 | Bacteria | 57733 |
| 102 | Ga0466715_008114 | 3300042616 | Bacteria | 7710 |
| 103 | Ga0466715_059303 | 3300042616 | Bacteria | 8334 |
| 104 | Ga0466715_469403 | 3300042616 | Bacteria | 2681 |
| 105 | Ga0466718_041192 | 3300042617 | Bacteria | 16593 |
| 106 | Ga0466716_035812 | 3300042605 | Bacteria | 2228 |
| 107 | Ga0466699_103448 | 3300042597 | Bacteria | 17010 |
| 108 | JGI24698J34947_10009268 | 3300002449 | Bacteria | 5401 |
| 109 | Ga0466729_231907 | 3300042621 | Bacteria | 2096 |
| 110 | Ga0466704_213067 | 3300042643 | Bacteria | 2377 |
| 111 | Ga0466704_332150 | 3300042643 | Unclassified | 11613 |
| 112 | Ga0466704_440761 | 3300042643 | Bacteria | 112604 |
| 113 | Ga0466704_591484 | 3300042643 | Bacteria | 4593 |
| 114 | Ga0466709_308001 | 3300042648 | Bacteria | 15552 |
| 115 | Ga0466727_135810 | 3300042655 | Bacteria | 2829 |
| 116 | Ga0466727_196397 | 3300042655 | Bacteria | 1754 |
| 117 | Ga0466733_155952 | 3300042659 | Bacteria | 3813 |
| 118 | Ga0466705_412513 | 3300042612 | Bacteria | 1617 |
| 119 | Ga0466712_121166 | 3300042614 | Bacteria | 6205 |
| 120 | Ga0466715_324723 | 3300042616 | Unclassified | 9303 |
| 121 | Ga0466718_044750 | 3300042617 | Bacteria | 14468 |
| 122 | Ga0466716_270056 | 3300042605 | Bacteria | 2369 |
| 123 | Ga0466719_188626 | 3300042606 | Bacteria | 3744 |
| 124 | Ga0466690_339568 | 3300042590 | Bacteria | 18062 |
| 125 | Ga0466691_005069 | 3300042593 | Bacteria | 11588 |
| 126 | Ga0466691_126102 | 3300042593 | Bacteria | 7955 |
| 127 | Ga0466691_167928 | 3300042593 | Bacteria | 7785 |
| 128 | Ga0466696_104524 | 3300042596 | Bacteria | 2573 |
| 129 | Ga0123357_10109471 | 3300009784 | Bacteria | 3529 |
| 130 | Ga0123355_10062422 | 3300009826 | Bacteria | 6014 |
| 131 | Ga0123353_10047247 | 3300010167 | Bacteria | 6844 |
| 132 | Ga0123353_10629781 | 3300010167 | Bacteria | 1524 |
| 133 | JGI24698J34947_10000878 | 3300002449 | Bacteria | 15193 |
| 134 | Ga0466703_325536 | 3300042636 | Bacteria | 19973 |
| 135 | Ga0466704_209487 | 3300042643 | Bacteria | 45601 |
| 136 | Ga0466709_149047 | 3300042648 | Bacteria | 3756 |
| 137 | Ga0466712_033533 | 3300042614 | Bacteria | 2645 |
| 138 | Ga0466711_032117 | 3300042615 | Bacteria | 31170 |
| 139 | Ga0466715_041933 | 3300042616 | Bacteria | 15732 |
| 140 | Ga0466726_402645 | 3300042619 | Bacteria | 1823 |
| 141 | Ga0466713_058963 | 3300042602 | Bacteria | 2197 |
| 142 | Ga0466716_476847 | 3300042605 | Bacteria | 2047 |
| 143 | Ga0466719_062853 | 3300042606 | Bacteria | 19370 |
| 144 | Ga0466719_372732 | 3300042606 | Bacteria | 7345 |
| 145 | Ga0466722_013230 | 3300042609 | Bacteria | 3036 |
| 146 | Ga0466722_224626 | 3300042609 | Bacteria | 2509 |
| 147 | Ga0466690_147226 | 3300042590 | Bacteria | 2441 |
| 148 | Ga0466692_022230 | 3300042591 | Bacteria | 1050 |
| 149 | Ga0466691_189017 | 3300042593 | Bacteria | 7532 |
| 150 | Ga0466691_228399 | 3300042593 | Bacteria | 1509 |
| 151 | Ga0123353_10534111 | 3300010167 | Bacteria | 1697 |
| 152 | Ga0123354_10281785 | 3300010882 | Bacteria | 1612 |
| 153 | Ga0466735_206367 | 3300042624 | Bacteria | 1727 |
| 154 | Ga0466703_100434 | 3300042636 | Bacteria | 11690 |
| 155 | Ga0466704_200355 | 3300042643 | Bacteria | 35576 |
| 156 | Ga0466704_293788 | 3300042643 | Bacteria | 2974 |
| 157 | Ga0466708_166069 | 3300042652 | Bacteria | 3313 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00248 | Aldo_ket_red | Aldo/keto reductase family | 16 | 279 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.