Protein Family IF07038
Metagenome
Isolate
211
Members
53
Samples
206
Scaffolds
266.51
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_011443|Ga0466705_011443_4024_4935
- Length
- 303 aa
- Sequence
- LGGGFSFENLSADWYIILGGFPPAARGKSKKRMPYLYETHLHTCQSSNCGVSRGREYIARYRDLGYTGIIVTDHFFRGNCAVDRNLPWRRWVDEFCRGYEDALNEGLRQGLDVFFAWEESYSGDDYLIYGLDRDWLYGHPECRSWTRRQQFEAVDQAGGCVVQAHPFRQHYYISRIILSTGCVHGVEAANAGNDEDSYDALARRYGERLGLAMTAGSDIHDAGLAAEGSSYGVILDERIKTPQDYARAVRTGRIRGLRMASGRCDFRGDERIRLPVDIRDGRDRPTGQDIWLFFQSRGTVVSR
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Kalotermitidae
25.5%
Unclassified
15.7%
Rhinotermitidae
7.8%
Termopsidae
5.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
2
Bacteria
196
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 46 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 49 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 50 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_314946 | 3300042600 | Bacteria | 2191 |
| 2 | Ga0466713_037012 | 3300042602 | Bacteria | 8995 |
| 3 | Ga0466719_024620 | 3300042606 | Bacteria | 18392 |
| 4 | Ga0466719_052414 | 3300042606 | Bacteria | 13658 |
| 5 | Ga0466722_118756 | 3300042609 | Bacteria | 8385 |
| 6 | Ga0466698_309626 | 3300042610 | Bacteria | 1264 |
| 7 | Ga0123353_10195883 | 3300010167 | Bacteria | 3185 |
| 8 | Ga0123353_10214147 | 3300010167 | Bacteria | 3019 |
| 9 | Ga0123354_10315479 | 3300010882 | Bacteria | 1452 |
| 10 | Ga0466729_218533 | 3300042621 | Bacteria | 4356 |
| 11 | Ga0466703_017455 | 3300042636 | Bacteria | 11426 |
| 12 | Ga0466703_071994 | 3300042636 | Bacteria | 30597 |
| 13 | Ga0466704_250006 | 3300042643 | Bacteria | 3681 |
| 14 | Ga0466708_250077 | 3300042652 | Bacteria | 2126 |
| 15 | Ga0466705_447873 | 3300042612 | Bacteria | 3265 |
| 16 | Ga0466705_460527 | 3300042612 | Bacteria | 1288 |
| 17 | Ga0466711_182244 | 3300042615 | Bacteria | 4354 |
| 18 | Ga0466715_106934 | 3300042616 | Bacteria | 1158 |
| 19 | Ga0466715_240696 | 3300042616 | Bacteria | 10020 |
| 20 | Ga0466715_299769 | 3300042616 | Bacteria | 2065 |
| 21 | Ga0466723_178055 | 3300042618 | Bacteria | 7626 |
| 22 | Ga0466726_049108 | 3300042619 | Bacteria | 43705 |
| 23 | Ga0466726_124282 | 3300042619 | Bacteria | 3329 |
| 24 | Ga0466726_304827 | 3300042619 | Bacteria | 3562 |
| 25 | Ga0264413_101566 | 3300024493 | Bacteria | 3367 |
| 26 | Ga0466690_305280 | 3300042590 | Bacteria | 8591 |
| 27 | Ga0466692_023701 | 3300042591 | Bacteria | 2839 |
| 28 | Ga0466691_081467 | 3300042593 | Bacteria | 7851 |
| 29 | Ga0466699_051976 | 3300042597 | Bacteria | 1217 |
| 30 | Ga0466699_235711 | 3300042597 | Bacteria | 1837 |
| 31 | 2230954191 | 2228664003 | Bacteria | 23075 |
| 32 | JGI24695J34938_10015250 | 3300002450 | Bacteria | 3949 |
| 33 | JGI24702J35022_10021685 | 3300002462 | Bacteria | 3481 |
| 34 | Ga0072941_1032235 | 3300005201 | Bacteria | 13582 |
| 35 | Ga0466706_221020 | 3300042599 | Bacteria | 1080 |
| 36 | Ga0466707_197732 | 3300042601 | Bacteria | 1005 |
| 37 | Ga0466707_322348 | 3300042601 | Bacteria | 3390 |
| 38 | Ga0466716_149253 | 3300042605 | Bacteria | 7171 |
| 39 | Ga0466719_270302 | 3300042606 | Bacteria | 1758 |
| 40 | Ga0466722_000982 | 3300042609 | Bacteria | 1632 |
| 41 | Ga0466722_007854 | 3300042609 | Unclassified | 1472 |
| 42 | Ga0466722_009194 | 3300042609 | Bacteria | 6052 |
| 43 | Ga0466722_187474 | 3300042609 | Bacteria | 5438 |
| 44 | Ga0123356_10012414 | 3300010049 | Archaea | 8268 |
| 45 | Ga0123356_10263034 | 3300010049 | Bacteria | 1810 |
| 46 | Ga0123353_10106646 | 3300010167 | Bacteria | 4514 |
| 47 | Ga0123354_10204391 | 3300010882 | Bacteria | 2159 |
| 48 | Ga0466702_240224 | 3300042635 | Bacteria | 13531 |
| 49 | Ga0466703_058865 | 3300042636 | Bacteria | 9689 |
| 50 | Ga0466727_164777 | 3300042655 | Bacteria | 2746 |
| 51 | Ga0466712_145208 | 3300042614 | Bacteria | 3220 |
| 52 | Ga0466712_230882 | 3300042614 | Bacteria | 58841 |
| 53 | Ga0466715_287096 | 3300042616 | Bacteria | 3486 |
| 54 | Ga0466718_048649 | 3300042617 | Bacteria | 16364 |
| 55 | Ga0466723_136051 | 3300042618 | Bacteria | 25946 |
| 56 | Ga0466726_051280 | 3300042619 | Bacteria | 1368 |
| 57 | Ga0264413_112413 | 3300024493 | Unclassified | 7888 |
| 58 | Ga0415639_005035 | 3300038395 | Bacteria | 4145 |
| 59 | Ga0466690_044680 | 3300042590 | Bacteria | 5047 |
| 60 | Ga0466692_184257 | 3300042591 | Bacteria | 20497 |
| 61 | Ga0466694_095307 | 3300042594 | Bacteria | 1716 |
| 62 | Ga0466699_249878 | 3300042597 | Bacteria | 9041 |
| 63 | JGI24698J34947_10000003 | 3300002449 | Bacteria | 62691 |
| 64 | JGI24695J34938_10001009 | 3300002450 | Bacteria | 25530 |
| 65 | JGI24695J34938_10009476 | 3300002450 | Bacteria | 5413 |
| 66 | Ga0068305_10047110 | 3300005083 | Bacteria | 4367 |
| 67 | Ga0072941_1004833 | 3300005201 | Bacteria | 19559 |
| 68 | Ga0072941_1020126 | 3300005201 | Bacteria | 7605 |
| 69 | Ga0466705_349783 | 3300042612 | Bacteria | 9907 |
| 70 | Ga0466732_177801 | 3300042656 | Bacteria | 6099 |
| 71 | Ga0466707_227223 | 3300042601 | Bacteria | 4038 |
| 72 | Ga0466707_271779 | 3300042601 | Bacteria | 1681 |
| 73 | Ga0466713_131658 | 3300042602 | Bacteria | 9602 |
| 74 | Ga0466722_155244 | 3300042609 | Bacteria | 4393 |
| 75 | Ga0466722_226083 | 3300042609 | Bacteria | 4726 |
| 76 | Ga0123357_10241585 | 3300009784 | Bacteria | 1954 |
| 77 | Ga0123353_10555309 | 3300010167 | Bacteria | 1655 |
| 78 | Ga0466735_201072 | 3300042624 | Bacteria | 1583 |
| 79 | Ga0466703_359367 | 3300042636 | Bacteria | 9600 |
| 80 | Ga0466711_302826 | 3300042615 | Bacteria | 2350 |
| 81 | Ga0466718_018365 | 3300042617 | Bacteria | 2286 |
| 82 | Ga0466718_142524 | 3300042617 | Bacteria | 17202 |
| 83 | Ga0466723_246723 | 3300042618 | Bacteria | 18930 |
| 84 | Ga0466690_105404 | 3300042590 | Bacteria | 4738 |
| 85 | Ga0466690_296826 | 3300042590 | Archaea | 2384 |
| 86 | Ga0466692_150847 | 3300042591 | Unclassified | 4141 |
| 87 | Ga0466691_199658 | 3300042593 | Bacteria | 2046 |
| 88 | Ga0466699_373901 | 3300042597 | Bacteria | 1294 |
| 89 | Ga0072941_1103602 | 3300005201 | Bacteria | 1310 |
| 90 | Ga0466733_118446 | 3300042659 | Unclassified | 1329 |
| 91 | Ga0466719_102351 | 3300042606 | Bacteria | 13783 |
| 92 | Ga0466722_063914 | 3300042609 | Bacteria | 3042 |
| 93 | Ga0466698_276586 | 3300042610 | Bacteria | 1458 |
| 94 | Ga0123356_10033974 | 3300010049 | Unclassified | 4770 |
| 95 | Ga0123356_10180278 | 3300010049 | Bacteria | 2133 |
| 96 | Ga0466702_309615 | 3300042635 | Bacteria | 3079 |
| 97 | Ga0466702_426710 | 3300042635 | Bacteria | 3751 |
| 98 | Ga0466704_274857 | 3300042643 | Bacteria | 37737 |
| 99 | Ga0466708_171357 | 3300042652 | Bacteria | 10707 |
| 100 | Ga0466727_183288 | 3300042655 | Bacteria | 1725 |
| 101 | Ga0466705_529205 | 3300042612 | Bacteria | 14793 |
| 102 | Ga0466712_126886 | 3300042614 | Unclassified | 2924 |
| 103 | Ga0466711_441473 | 3300042615 | Bacteria | 41991 |
| 104 | Ga0466715_034563 | 3300042616 | Bacteria | 2349 |
| 105 | Ga0466723_103192 | 3300042618 | Bacteria | 8793 |
| 106 | Ga0466726_472021 | 3300042619 | Bacteria | 1358 |
| 107 | Ga0466728_122820 | 3300042620 | Bacteria | 13543 |
| 108 | Ga0264413_101480 | 3300024493 | Bacteria | 5537 |
| 109 | Ga0264413_113690 | 3300024493 | Bacteria | 1380 |
| 110 | Ga0264413_122756 | 3300024493 | Bacteria | 1787 |
| 111 | Ga0466692_191398 | 3300042591 | Unclassified | 1533 |
| 112 | Ga0466691_061321 | 3300042593 | Bacteria | 7090 |
| 113 | Ga0466691_079440 | 3300042593 | Bacteria | 17830 |
| 114 | Ga0466699_062710 | 3300042597 | Bacteria | 2246 |
| 115 | Ga0466699_277235 | 3300042597 | Bacteria | 1157 |
| 116 | JGI24698J34947_10013936 | 3300002449 | Unclassified | 4382 |
| 117 | JGI24698J34947_10065326 | 3300002449 | Bacteria | 1774 |
| 118 | JGI24705J35276_12201610 | 3300002504 | Unclassified | 1621 |
| 119 | Ga0072941_1293857 | 3300005201 | Bacteria | 1041 |
| 120 | Ga0466705_174607 | 3300042612 | Bacteria | 3476 |
| 121 | Ga0466700_230563 | 3300042600 | Bacteria | 1153 |
| 122 | Ga0123356_10241926 | 3300010049 | Bacteria | 1876 |
| 123 | Ga0123353_10567548 | 3300010167 | Bacteria | 1632 |
| 124 | Ga0466735_187697 | 3300042624 | Bacteria | 1205 |
| 125 | Ga0466704_141943 | 3300042643 | Bacteria | 51616 |
| 126 | Ga0466709_166302 | 3300042648 | Bacteria | 1887 |
| 127 | Ga0466708_222154 | 3300042652 | Bacteria | 5389 |
| 128 | Ga0466715_134845 | 3300042616 | Bacteria | 1535 |
| 129 | Ga0466718_127138 | 3300042617 | Bacteria | 1407 |
| 130 | Ga0466723_070492 | 3300042618 | Bacteria | 10382 |
| 131 | Ga0466723_324228 | 3300042618 | Bacteria | 9300 |
| 132 | Ga0466726_256216 | 3300042619 | Bacteria | 5066 |
| 133 | Ga0466728_341087 | 3300042620 | Bacteria | 4420 |
| 134 | Ga0456237_0001085 | 3300041968 | Bacteria | 4291 |
| 135 | Ga0466693_053186 | 3300042592 | Bacteria | 13861 |
| 136 | Ga0466691_083061 | 3300042593 | Bacteria | 22657 |
| 137 | Ga0466694_189698 | 3300042594 | Bacteria | 15080 |
| 138 | Ga0466699_194760 | 3300042597 | Bacteria | 2186 |
| 139 | Ga0466699_218465 | 3300042597 | Bacteria | 2778 |
| 140 | JGI24695J34938_10013138 | 3300002450 | Bacteria | 4359 |
| 141 | Ga0072941_1087050 | 3300005201 | Bacteria | 2924 |
| 142 | Ga0466705_011443 | 3300042612 | Bacteria | 5195 |
| 143 | Ga0466716_013043 | 3300042605 | Bacteria | 4395 |
| 144 | Ga0466716_446303 | 3300042605 | Bacteria | 11310 |
| 145 | Ga0123356_10000407 | 3300010049 | Bacteria | 48938 |
| 146 | Ga0123353_10026156 | 3300010167 | Bacteria | 8907 |
| 147 | Ga0123353_10075591 | 3300010167 | Bacteria | 5412 |
| 148 | Ga0123353_10098498 | 3300010167 | Bacteria | 4712 |
| 149 | Ga0466702_177076 | 3300042635 | Bacteria | 26172 |
| 150 | Ga0466703_314780 | 3300042636 | Bacteria | 20220 |
| 151 | Ga0466704_100377 | 3300042643 | Bacteria | 3664 |
| 152 | Ga0466704_277149 | 3300042643 | Bacteria | 13738 |
| 153 | Ga0466709_347680 | 3300042648 | Bacteria | 22254 |
| 154 | Ga0466708_118134 | 3300042652 | Unclassified | 1119 |
| 155 | Ga0466715_298930 | 3300042616 | Bacteria | 14048 |
| 156 | Ga0466723_027981 | 3300042618 | Bacteria | 3278 |
| 157 | Ga0466726_139748 | 3300042619 | Bacteria | 3206 |
| 158 | Ga0466693_425777 | 3300042592 | Bacteria | 1113 |
| 159 | Ga0466694_286024 | 3300042594 | Bacteria | 3040 |
| 160 | Ga0466699_014381 | 3300042597 | Bacteria | 11424 |
| 161 | Ga0466699_014843 | 3300042597 | Bacteria | 1575 |
| 162 | Ga0466699_108038 | 3300042597 | Bacteria | 5334 |
| 163 | Ga0466699_255355 | 3300042597 | Bacteria | 1919 |
| 164 | AustNasuHG_c1017352 | 3300000089 | Bacteria | 2396 |
| 165 | JGI24698J34947_10000327 | 3300002449 | Bacteria | 21005 |
| 166 | JGI24695J34938_10000010 | 3300002450 | Bacteria | 132147 |
| 167 | Ga0466705_295917 | 3300042612 | Bacteria | 4848 |
| 168 | Ga0466707_161036 | 3300042601 | Bacteria | 10489 |
| 169 | Ga0466707_351381 | 3300042601 | Bacteria | 3724 |
| 170 | Ga0466713_128735 | 3300042602 | Bacteria | 5991 |
| 171 | Ga0466719_055153 | 3300042606 | Bacteria | 3511 |
| 172 | Ga0466719_489235 | 3300042606 | Bacteria | 1209 |
| 173 | Ga0466720_234108 | 3300042607 | Bacteria | 1100 |
| 174 | Ga0466722_133986 | 3300042609 | Bacteria | 1605 |
| 175 | Ga0466722_225164 | 3300042609 | Bacteria | 2345 |
| 176 | Ga0123356_10003143 | 3300010049 | Bacteria | 17393 |
| 177 | Ga0123356_10060440 | 3300010049 | Bacteria | 3536 |
| 178 | Ga0123356_10192615 | 3300010049 | Bacteria | 2071 |
| 179 | Ga0466735_010614 | 3300042624 | Bacteria | 1042 |
| 180 | Ga0466703_147842 | 3300042636 | Bacteria | 1183 |
| 181 | Ga0466709_381462 | 3300042648 | Bacteria | 14014 |
| 182 | Ga0466708_347822 | 3300042652 | Unclassified | 2301 |
| 183 | Ga0466727_061688 | 3300042655 | Bacteria | 1654 |
| 184 | Ga0466712_180004 | 3300042614 | Bacteria | 1506 |
| 185 | Ga0466711_136175 | 3300042615 | Bacteria | 10212 |
| 186 | Ga0466728_022104 | 3300042620 | Bacteria | 5293 |
| 187 | Ga0456237_0013584 | 3300041968 | Unclassified | 1168 |
| 188 | Ga0466691_204161 | 3300042593 | Bacteria | 13310 |
| 189 | AustNasuHG_c1035456 | 3300000089 | Bacteria | 1313 |
| 190 | JGI24695J34938_10000183 | 3300002450 | Bacteria | 58582 |
| 191 | Ga0466727_351835 | 3300042655 | Bacteria | 23710 |
| 192 | Ga0466707_389965 | 3300042601 | Bacteria | 1116 |
| 193 | Ga0123357_10329325 | 3300009784 | Bacteria | 1495 |
| 194 | Ga0123356_10708132 | 3300010049 | Bacteria | 1176 |
| 195 | Ga0123353_10520884 | 3300010167 | Bacteria | 1725 |
| 196 | Ga0466704_281120 | 3300042643 | Bacteria | 6310 |
| 197 | Ga0466708_394867 | 3300042652 | Bacteria | 13217 |
| 198 | Ga0466715_099266 | 3300042616 | Bacteria | 8983 |
| 199 | Ga0466715_486861 | 3300042616 | Bacteria | 1324 |
| 200 | Ga0466726_038755 | 3300042619 | Bacteria | 1934 |
| 201 | Ga0466690_010944 | 3300042590 | Bacteria | 2726 |
| 202 | Ga0466690_162523 | 3300042590 | Bacteria | 11471 |
| 203 | Ga0466690_296760 | 3300042590 | Unclassified | 11758 |
| 204 | Ga0466692_001136 | 3300042591 | Bacteria | 14718 |
| 205 | JGI24695J34938_10000117 | 3300002450 | Bacteria | 71696 |
| 206 | JGI24695J34938_10037573 | 3300002450 | Bacteria | 2199 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.