Protein Family IF06954
Metagenome
Isolate
120
Members
44
Samples
114
Scaffolds
111.47
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_380613|Ga0466698_380613_247_582
- Length
- 111 aa
- Sequence
- MGKFMKGDIVVMPFPFSDLSGSKRRPALVVANISGEDVILCQITSVARNDNYAVPINMTDFESGTLPAEESFIRPNKIFTADRKLVIYHACRLKPEKMKAITSAIVKMLEK
Sample Types
Isolate
5.0%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.3%
Unclassified
18.2%
Kalotermitidae
13.6%
Termopsidae
6.8%
Rhinotermitidae
4.5%
Hodotermitidae
2.3%
Passalidae
2.3%
Taxonomy
Archaea
3
Bacteria
96
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 23 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 29 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 30 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_157941 | 3300042659 | Unclassified | 5489 |
| 2 | Ga0123356_10013437 | 3300010049 | Bacteria | 7901 |
| 3 | Ga0123356_10326968 | 3300010049 | Unclassified | 1648 |
| 4 | Ga0123356_11581676 | 3300010049 | Bacteria | 811 |
| 5 | Ga0123353_10359099 | 3300010167 | Bacteria | 2190 |
| 6 | Ga0466731_077963 | 3300042622 | Bacteria | 1196 |
| 7 | Ga0466703_046757 | 3300042636 | Bacteria | 3043 |
| 8 | Ga0466703_145688 | 3300042636 | Bacteria | 9764 |
| 9 | Ga0466703_235950 | 3300042636 | Bacteria | 5870 |
| 10 | Ga0466727_159826 | 3300042655 | Unclassified | 1063 |
| 11 | Ga0466727_324936 | 3300042655 | Bacteria | 1356 |
| 12 | Ga0466712_228211 | 3300042614 | Bacteria | 5696 |
| 13 | Ga0466726_446620 | 3300042619 | Bacteria | 1657 |
| 14 | JGI24698J34947_10015441 | 3300002449 | Unclassified | 4156 |
| 15 | JGI24695J34938_10025804 | 3300002450 | Bacteria | 2802 |
| 16 | JGI24695J34938_10099420 | 3300002450 | Bacteria | 1189 |
| 17 | JGI24702J35022_10012195 | 3300002462 | Bacteria | 4783 |
| 18 | Ga0068302_10059547 | 3300005071 | Unclassified | 2832 |
| 19 | Ga0466691_050041 | 3300042593 | Bacteria | 1512 |
| 20 | Ga0466700_197341 | 3300042600 | Bacteria | 1571 |
| 21 | Ga0466698_380613 | 3300042610 | Bacteria | 3089 |
| 22 | Ga0123353_11190471 | 3300010167 | Bacteria | 1001 |
| 23 | Ga0466705_124958 | 3300042612 | Bacteria | 1131 |
| 24 | Ga0466712_009511 | 3300042614 | Bacteria | 1260 |
| 25 | JGI24695J34938_10007422 | 3300002450 | Bacteria | 6418 |
| 26 | JGI24695J34938_10016354 | 3300002450 | Unclassified | 3774 |
| 27 | JGI24695J34938_10048272 | 3300002450 | Bacteria | 1876 |
| 28 | Ga0466692_013229 | 3300042591 | Archaea | 2233 |
| 29 | Ga0466692_202713 | 3300042591 | Bacteria | 2673 |
| 30 | Ga0466721_288631 | 3300042608 | Bacteria | 1311 |
| 31 | Ga0123357_10633379 | 3300009784 | Bacteria | 801 |
| 32 | Ga0123356_10002839 | 3300010049 | Bacteria | 18336 |
| 33 | Ga0123353_11015663 | 3300010167 | Bacteria | 1112 |
| 34 | Ga0466705_306730 | 3300042612 | Unclassified | 3284 |
| 35 | Ga0466702_402240 | 3300042635 | Bacteria | 3183 |
| 36 | Ga0466703_123573 | 3300042636 | Bacteria | 2744 |
| 37 | Ga0466727_140832 | 3300042655 | Bacteria | 1441 |
| 38 | Ga0466712_191517 | 3300042614 | Bacteria | 1330 |
| 39 | Ga0466712_306174 | 3300042614 | Bacteria | 1583 |
| 40 | Ga0466726_025610 | 3300042619 | Bacteria | 29701 |
| 41 | Ga0466728_247713 | 3300042620 | Bacteria | 1526 |
| 42 | JGI24695J34938_10056149 | 3300002450 | Bacteria | 1699 |
| 43 | Ga0072940_1028700 | 3300005200 | Archaea | 2621 |
| 44 | Ga0466733_164805 | 3300042659 | Bacteria | 1883 |
| 45 | Ga0466692_076349 | 3300042591 | Bacteria | 1738 |
| 46 | Ga0466692_174336 | 3300042591 | Bacteria | 2811 |
| 47 | Ga0466699_083903 | 3300042597 | Bacteria | 1642 |
| 48 | Ga0466699_085078 | 3300042597 | Bacteria | 2237 |
| 49 | Ga0466699_425977 | 3300042597 | Unclassified | 18731 |
| 50 | Ga0466707_078187 | 3300042601 | Bacteria | 2967 |
| 51 | Ga0123355_10484570 | 3300009826 | Bacteria | 1536 |
| 52 | Ga0123356_11674330 | 3300010049 | Bacteria | 789 |
| 53 | Ga0466705_258800 | 3300042612 | Bacteria | 1625 |
| 54 | Ga0466731_345946 | 3300042622 | Unclassified | 2464 |
| 55 | Ga0466734_071543 | 3300042623 | Bacteria | 1115 |
| 56 | Ga0466703_166576 | 3300042636 | Bacteria | 3957 |
| 57 | Ga0466704_466744 | 3300042643 | Bacteria | 1512 |
| 58 | Ga0466727_315384 | 3300042655 | Bacteria | 1122 |
| 59 | Ga0466712_048758 | 3300042614 | Bacteria | 6395 |
| 60 | Ga0466726_069884 | 3300042619 | Bacteria | 1009 |
| 61 | Ga0466726_094860 | 3300042619 | Bacteria | 1322 |
| 62 | Ga0466726_486605 | 3300042619 | Unclassified | 1189 |
| 63 | 2227469228 | 2225789004 | Bacteria | 939 |
| 64 | JGI24698J34947_10021030 | 3300002449 | Bacteria | 3512 |
| 65 | JGI24698J34947_10072243 | 3300002449 | Unclassified | 1652 |
| 66 | JGI24698J34947_10113731 | 3300002449 | Bacteria | 1189 |
| 67 | JGI24699J35502_10798477 | 3300002509 | Bacteria | 877 |
| 68 | Ga0466692_042575 | 3300042591 | Bacteria | 1902 |
| 69 | Ga0466693_021526 | 3300042592 | Bacteria | 40073 |
| 70 | Ga0466700_476989 | 3300042600 | Unclassified | 1539 |
| 71 | Ga0466734_031772 | 3300042623 | Bacteria | 1237 |
| 72 | Ga0466704_212671 | 3300042643 | Bacteria | 4080 |
| 73 | Ga0466704_418604 | 3300042643 | Unclassified | 4316 |
| 74 | Ga0466728_215762 | 3300042620 | Bacteria | 1523 |
| 75 | JGI24698J34947_10123379 | 3300002449 | Bacteria | 1120 |
| 76 | JGI24695J34938_10050862 | 3300002450 | Bacteria | 1816 |
| 77 | Ga0072940_1075134 | 3300005200 | Unclassified | 3735 |
| 78 | Ga0466732_113242 | 3300042656 | Bacteria | 1649 |
| 79 | Ga0466706_266883 | 3300042599 | Bacteria | 1874 |
| 80 | Ga0466722_194019 | 3300042609 | Bacteria | 1872 |
| 81 | Ga0123355_10375735 | 3300009826 | Bacteria | 1857 |
| 82 | Ga0123356_10033413 | 3300010049 | Bacteria | 4810 |
| 83 | Ga0123356_10094338 | 3300010049 | Archaea | 2857 |
| 84 | Ga0123356_10421020 | 3300010049 | Bacteria | 1478 |
| 85 | Ga0466727_097848 | 3300042655 | Bacteria | 1439 |
| 86 | Ga0466715_240701 | 3300042616 | Bacteria | 6899 |
| 87 | JGI24695J34938_10153628 | 3300002450 | Unclassified | 944 |
| 88 | JGI24702J35022_10056663 | 3300002462 | Unclassified | 2091 |
| 89 | JGI24702J35022_10197932 | 3300002462 | Unclassified | 1149 |
| 90 | Ga0466692_027575 | 3300042591 | Unclassified | 4681 |
| 91 | Ga0466691_159527 | 3300042593 | Bacteria | 2308 |
| 92 | Ga0466695_295057 | 3300042595 | Bacteria | 1686 |
| 93 | Ga0466699_194569 | 3300042597 | Unclassified | 1454 |
| 94 | Ga0466700_191619 | 3300042600 | Bacteria | 1370 |
| 95 | Ga0466707_193322 | 3300042601 | Bacteria | 1233 |
| 96 | Ga0466707_319918 | 3300042601 | Bacteria | 1209 |
| 97 | Ga0466713_154933 | 3300042602 | Bacteria | 2452 |
| 98 | Ga0466717_106313 | 3300042604 | Bacteria | 1356 |
| 99 | Ga0123356_10269375 | 3300010049 | Bacteria | 1792 |
| 100 | Ga0123353_11634649 | 3300010167 | Bacteria | 811 |
| 101 | Ga0466727_235201 | 3300042655 | Bacteria | 1846 |
| 102 | Ga0466712_271103 | 3300042614 | Bacteria | 6967 |
| 103 | Ga0466726_252900 | 3300042619 | Bacteria | 3412 |
| 104 | JGI24695J34938_10230013 | 3300002450 | Bacteria | 781 |
| 105 | JGI24699J35502_10714420 | 3300002509 | Unclassified | 780 |
| 106 | JGI24696J40584_12625440 | 3300002834 | Bacteria | 674 |
| 107 | Ga0466727_351722 | 3300042655 | Unclassified | 1009 |
| 108 | Ga0123356_11053618 | 3300010049 | Bacteria | 982 |
| 109 | Ga0466704_371298 | 3300042643 | Bacteria | 1330 |
| 110 | Ga0466726_062875 | 3300042619 | Bacteria | 2160 |
| 111 | Ga0466726_229060 | 3300042619 | Bacteria | 1671 |
| 112 | JGI24698J34947_10088207 | 3300002449 | Bacteria | 1432 |
| 113 | JGI24695J34938_10054313 | 3300002450 | Bacteria | 1738 |
| 114 | JGI24695J34938_10124509 | 3300002450 | Bacteria | 1050 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042659 | Ga0466733_157941 | Ga0466733_157941_4782_5051 | 89 |
| 2 | 3300042619 | Ga0466726_486605 | Ga0466726_486605_233_511 | 92 |
| 3 | 3300042595 | Ga0466695_295057 | Ga0466695_295057_267_596 | 109 |
| 4 | 3300042601 | Ga0466707_078187 | Ga0466707_078187_2569_2898 | 109 |
| 5 | 3300042601 | Ga0466707_319918 | Ga0466707_319918_430_759 | 109 |
| 6 | 3300042636 | Ga0466703_123573 | Ga0466703_123573_1540_1869 | 109 |
| 7 | iso_pr_bacteria | 2820252425 | 2820253168 | 109 |
| 8 | 2225789004 | 2227469228 | 2227912851 | 110 |
| 9 | 3300002449 | JGI24698J34947_10113731 | JGI24698J34947_101137311 | 110 |
| 10 | 3300002462 | JGI24702J35022_10056663 | JGI24702J35022_100566631 | 110 |
| 11 | 3300002462 | JGI24702J35022_10197932 | JGI24702J35022_101979322 | 110 |
| 12 | 3300010049 | Ga0123356_10033413 | Ga0123356_100334135 | 110 |
| 13 | 3300042591 | Ga0466692_027575 | Ga0466692_027575_3604_3936 | 110 |
| 14 | 3300042591 | Ga0466692_076349 | Ga0466692_076349_729_1061 | 110 |
| 15 | 3300042592 | Ga0466693_021526 | Ga0466693_021526_19546_19878 | 110 |
| 16 | 3300042593 | Ga0466691_159527 | Ga0466691_159527_487_819 | 110 |
| 17 | 3300042597 | Ga0466699_083903 | Ga0466699_083903_1021_1353 | 110 |
| 18 | 3300042597 | Ga0466699_085078 | Ga0466699_085078_1349_1681 | 110 |
| 19 | 3300042597 | Ga0466699_194569 | Ga0466699_194569_282_614 | 110 |
| 20 | 3300042597 | Ga0466699_425977 | Ga0466699_425977_584_916 | 110 |
| 21 | 3300042599 | Ga0466706_266883 | Ga0466706_266883_1294_1626 | 110 |
| 22 | 3300042600 | Ga0466700_191619 | Ga0466700_191619_904_1236 | 110 |
| 23 | 3300042600 | Ga0466700_197341 | Ga0466700_197341_1045_1377 | 110 |
| 24 | 3300042600 | Ga0466700_476989 | Ga0466700_476989_468_800 | 110 |
| 25 | 3300042604 | Ga0466717_106313 | Ga0466717_106313_45_377 | 110 |
| 26 | 3300042609 | Ga0466722_194019 | Ga0466722_194019_382_714 | 110 |
| 27 | 3300042612 | Ga0466705_306730 | Ga0466705_306730_135_467 | 110 |
| 28 | 3300042614 | Ga0466712_009511 | Ga0466712_009511_215_547 | 110 |
| 29 | 3300042614 | Ga0466712_048758 | Ga0466712_048758_1320_1652 | 110 |
| 30 | 3300042614 | Ga0466712_191517 | Ga0466712_191517_283_615 | 110 |
| 31 | 3300042614 | Ga0466712_228211 | Ga0466712_228211_3829_4161 | 110 |
| 32 | 3300042614 | Ga0466712_271103 | Ga0466712_271103_4142_4474 | 110 |
| 33 | 3300042614 | Ga0466712_306174 | Ga0466712_306174_805_1137 | 110 |
| 34 | 3300042619 | Ga0466726_025610 | Ga0466726_025610_7647_7979 | 110 |
| 35 | 3300042619 | Ga0466726_062875 | Ga0466726_062875_1593_1925 | 110 |
| 36 | 3300042619 | Ga0466726_069884 | Ga0466726_069884_429_761 | 110 |
| 37 | 3300042619 | Ga0466726_094860 | Ga0466726_094860_372_704 | 110 |
| 38 | 3300042619 | Ga0466726_229060 | Ga0466726_229060_360_692 | 110 |
| 39 | 3300042619 | Ga0466726_252900 | Ga0466726_252900_68_400 | 110 |
| 40 | 3300042620 | Ga0466728_247713 | Ga0466728_247713_231_563 | 110 |
| 41 | 3300042622 | Ga0466731_077963 | Ga0466731_077963_810_1142 | 110 |
| 42 | 3300042622 | Ga0466731_345946 | Ga0466731_345946_1340_1672 | 110 |
| 43 | 3300042623 | Ga0466734_031772 | Ga0466734_031772_569_901 | 110 |
| 44 | 3300042623 | Ga0466734_071543 | Ga0466734_071543_398_730 | 110 |
| 45 | 3300042635 | Ga0466702_402240 | Ga0466702_402240_2609_2941 | 110 |
| 46 | 3300042636 | Ga0466703_046757 | Ga0466703_046757_1108_1440 | 110 |
| 47 | 3300042643 | Ga0466704_466744 | Ga0466704_466744_481_813 | 110 |
| 48 | 3300042655 | Ga0466727_235201 | Ga0466727_235201_468_800 | 110 |
| 49 | 3300042655 | Ga0466727_315384 | Ga0466727_315384_506_838 | 110 |
| 50 | 3300042655 | Ga0466727_324936 | Ga0466727_324936_972_1304 | 110 |
| 51 | 3300042659 | Ga0466733_164805 | Ga0466733_164805_1160_1492 | 110 |
| 52 | iso_pr_bacteria | 2772190978 | 2773731247 | 110 |
| 53 | iso_pr_bacteria | 2781125637 | 2781282127 | 110 |
| 54 | iso_pr_bacteria | 2781125659 | 2781328400 | 110 |
| 55 | 3300002449 | JGI24698J34947_10015441 | JGI24698J34947_100154411 | 111 |
| 56 | 3300002449 | JGI24698J34947_10021030 | JGI24698J34947_100210303 | 111 |
| 57 | 3300002449 | JGI24698J34947_10072243 | JGI24698J34947_100722432 | 111 |
| 58 | 3300002449 | JGI24698J34947_10088207 | JGI24698J34947_100882073 | 111 |
| 59 | 3300002449 | JGI24698J34947_10123379 | JGI24698J34947_101233793 | 111 |
| 60 | 3300002450 | JGI24695J34938_10007422 | JGI24695J34938_100074226 | 111 |
| 61 | 3300002450 | JGI24695J34938_10016354 | JGI24695J34938_100163542 | 111 |
| 62 | 3300002450 | JGI24695J34938_10025804 | JGI24695J34938_100258043 | 111 |
| 63 | 3300002450 | JGI24695J34938_10048272 | JGI24695J34938_100482722 | 111 |
| 64 | 3300002450 | JGI24695J34938_10050862 | JGI24695J34938_100508622 | 111 |
| 65 | 3300002450 | JGI24695J34938_10054313 | JGI24695J34938_100543133 | 111 |
| 66 | 3300002450 | JGI24695J34938_10056149 | JGI24695J34938_100561492 | 111 |
| 67 | 3300002450 | JGI24695J34938_10124509 | JGI24695J34938_101245091 | 111 |
| 68 | 3300002450 | JGI24695J34938_10153628 | JGI24695J34938_101536282 | 111 |
| 69 | 3300002450 | JGI24695J34938_10230013 | JGI24695J34938_102300133 | 111 |
| 70 | 3300002462 | JGI24702J35022_10012195 | JGI24702J35022_100121954 | 111 |
| 71 | 3300002509 | JGI24699J35502_10714420 | JGI24699J35502_107144202 | 111 |
| 72 | 3300002509 | JGI24699J35502_10798477 | JGI24699J35502_107984772 | 111 |
| 73 | 3300002834 | JGI24696J40584_12625440 | JGI24696J40584_126254401 | 111 |
| 74 | 3300005071 | Ga0068302_10059547 | Ga0068302_100595474 | 111 |
| 75 | 3300009784 | Ga0123357_10633379 | Ga0123357_106333792 | 111 |
| 76 | 3300009826 | Ga0123355_10484570 | Ga0123355_104845704 | 111 |
| 77 | 3300010049 | Ga0123356_10013437 | Ga0123356_100134375 | 111 |
| 78 | 3300010049 | Ga0123356_10094338 | Ga0123356_100943383 | 111 |
| 79 | 3300010049 | Ga0123356_10326968 | Ga0123356_103269683 | 111 |
| 80 | 3300010049 | Ga0123356_11053618 | Ga0123356_110536182 | 111 |
| 81 | 3300010049 | Ga0123356_11581676 | Ga0123356_115816762 | 111 |
| 82 | 3300010049 | Ga0123356_11674330 | Ga0123356_116743301 | 111 |
| 83 | 3300010167 | Ga0123353_10359099 | Ga0123353_103590992 | 111 |
| 84 | 3300010167 | Ga0123353_11015663 | Ga0123353_110156632 | 111 |
| 85 | 3300010167 | Ga0123353_11190471 | Ga0123353_111904712 | 111 |
| 86 | 3300010167 | Ga0123353_11634649 | Ga0123353_116346492 | 111 |
| 87 | 3300042608 | Ga0466721_288631 | Ga0466721_288631_357_692 | 111 |
| 88 | 3300042610 | Ga0466698_380613 | Ga0466698_380613_247_582 | 111 |
| 89 | iso_pr_bacteria | 2781125657 | 2781324262 | 111 |
| 90 | 3300005200 | Ga0072940_1028700 | Ga0072940_10287002 | 112 |
| 91 | 3300010049 | Ga0123356_10002839 | Ga0123356_100028399 | 112 |
| 92 | 3300010049 | Ga0123356_10269375 | Ga0123356_102693754 | 112 |
| 93 | 3300042591 | Ga0466692_013229 | Ga0466692_013229_530_868 | 112 |
| 94 | 3300042591 | Ga0466692_042575 | Ga0466692_042575_163_501 | 112 |
| 95 | 3300042591 | Ga0466692_174336 | Ga0466692_174336_1773_2111 | 112 |
| 96 | 3300042591 | Ga0466692_202713 | Ga0466692_202713_2236_2574 | 112 |
| 97 | 3300042616 | Ga0466715_240701 | Ga0466715_240701_1117_1455 | 112 |
| 98 | 3300042619 | Ga0466726_446620 | Ga0466726_446620_709_1047 | 112 |
| 99 | 3300042655 | Ga0466727_351722 | Ga0466727_351722_546_884 | 112 |
| 100 | 3300002450 | JGI24695J34938_10099420 | JGI24695J34938_100994203 | 113 |
| 101 | 3300042612 | Ga0466705_124958 | Ga0466705_124958_471_812 | 113 |
| 102 | 3300042612 | Ga0466705_258800 | Ga0466705_258800_1088_1429 | 113 |
| 103 | 3300042620 | Ga0466728_215762 | Ga0466728_215762_996_1337 | 113 |
| 104 | 3300042643 | Ga0466704_212671 | Ga0466704_212671_767_1108 | 113 |
| 105 | 3300042643 | Ga0466704_371298 | Ga0466704_371298_433_774 | 113 |
| 106 | 3300042643 | Ga0466704_418604 | Ga0466704_418604_1895_2236 | 113 |
| 107 | 3300042601 | Ga0466707_193322 | Ga0466707_193322_171_518 | 115 |
| 108 | 3300042636 | Ga0466703_166576 | Ga0466703_166576_82_429 | 115 |
| 109 | iso_pr_bacteria | 2781125681 | 2781407809 | 115 |
| 110 | 3300010049 | Ga0123356_10421020 | Ga0123356_104210203 | 116 |
| 111 | 3300042602 | Ga0466713_154933 | Ga0466713_154933_1826_2182 | 118 |
| 112 | 3300042655 | Ga0466727_097848 | Ga0466727_097848_640_1002 | 120 |
| 113 | 3300042656 | Ga0466732_113242 | Ga0466732_113242_158_520 | 120 |
| 114 | 3300009826 | Ga0123355_10375735 | Ga0123355_103757353 | 121 |
| 115 | 3300042593 | Ga0466691_050041 | Ga0466691_050041_605_970 | 121 |
| 116 | 3300042636 | Ga0466703_235950 | Ga0466703_235950_5297_5662 | 121 |
| 117 | 3300042655 | Ga0466727_140832 | Ga0466727_140832_122_487 | 121 |
| 118 | 3300042655 | Ga0466727_159826 | Ga0466727_159826_341_706 | 121 |
| 119 | 3300005200 | Ga0072940_1075134 | Ga0072940_10751343 | 126 |
| 120 | 3300042636 | Ga0466703_145688 | Ga0466703_145688_7545_7949 | 134 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 6 | 109 | 0.84 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.