Protein Family IF06946

Metagenome Isolate
237 Members
68 Samples
219 Scaffolds
315.78 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_280992|Ga0466698_280992_319_1416
Length
365 aa
Sequence
MLIRNVKGGTKYSYIYFEPVHVLTKISNDDSMYLHIVQTSVYINYQGRLCMKILVTATSFKPDSDSPAMNKLRSFADSLVFNPGGKPLAEDELIPLLADCDGCIAGLDHFTARVIESAPNLKVISRYGAGVDRVDLAAARARNIVVCNTPGANSQAVADLTFALLLCVARRVSVLDQKTRQGQWPRSTGIELYGKTIGILGLGAIGKAVARRASGFSMKILAYDPFIDRKYAESNGIFPADFDAVTREADFLCLHLPLTDETRHIISKDVMRTMKKGAIIVNTARGGLIDEDAAYEFLVSGHLGGMGLDVYEAEPPQKSPLFDLENVVLTPHTASHTVEATTAMAEMSVQNLIDVLSGKDCPYIV

📊 Sample Types

Isolate 7.6%
Metagenome 92.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Unclassified 29.2%
Kalotermitidae 20.0%
Termopsidae 6.2%
Rhinotermitidae 4.6%

🌳 Taxonomy

Archaea 1
Bacteria 216
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
14 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
15 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
25 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
26 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
27 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
28 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
44 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
51 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
52 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
53 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
54 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
55 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
56 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
57 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
58 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
59 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
60 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
61 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
62 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
63 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
64 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
65 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
66 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
67 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
68 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_159079 3300042614 Bacteria 2261
2 Ga0466712_233685 3300042614 Bacteria 5560
3 Ga0466712_281013 3300042614 Unclassified 1857
4 Ga0466715_443705 3300042616 Bacteria 2061
5 Ga0466715_595048 3300042616 Bacteria 23345
6 Ga0466723_268749 3300042618 Unclassified 3393
7 Ga0466726_156072 3300042619 Bacteria 1402
8 Ga0123356_10198707 3300010049 Bacteria 2043
9 Ga0466727_165780 3300042655 Bacteria 4586
10 Ga0264413_136248 3300024493 Unclassified 2444
11 Ga0466692_014024 3300042591 Bacteria 3076
12 Ga0466699_173693 3300042597 Bacteria 2146
13 Ga0466716_060236 3300042605 Bacteria 3922
14 Ga0466719_001228 3300042606 Bacteria 4050
15 Ga0466720_061472 3300042607 Bacteria 2378
16 Ga0466720_122789 3300042607 Bacteria 6812
17 Ga0466698_179549 3300042610 Unclassified 1928
18 JGI24698J34947_10013433 3300002449 Bacteria 4472
19 JGI24698J34947_10028969 3300002449 Bacteria 2929
20 JGI24698J34947_10040307 3300002449 Bacteria 2412
21 JGI24698J34947_10077993 3300002449 Bacteria 1564
22 JGI24695J34938_10030746 3300002450 Bacteria 2497
23 JGI24695J34938_10032327 3300002450 Bacteria 2418
24 JGI24695J34938_10060722 3300002450 Bacteria 1612
25 JGI24702J35022_10001894 3300002462 Bacteria 12869
26 Ga0068302_10438194 3300005071 Bacteria 2154
27 Ga0072941_1266129 3300005201 Bacteria 1261
28 Ga0466732_260625 3300042656 Bacteria 3260
29 Ga0466712_092440 3300042614 Bacteria 1572
30 Ga0466712_108959 3300042614 Bacteria 9045
31 Ga0466712_269443 3300042614 Bacteria 1263
32 Ga0466712_306961 3300042614 Bacteria 1566
33 Ga0466715_175010 3300042616 Bacteria 4467
34 Ga0466718_153093 3300042617 Bacteria 1924
35 Ga0123353_10164829 3300010167 Bacteria 3524
36 Ga0123353_10171412 3300010167 Bacteria 3444
37 Ga0466704_160392 3300042643 Bacteria 3008
38 Ga0466709_001189 3300042648 Bacteria 1629
39 Ga0466727_045971 3300042655 Bacteria 1059
40 Ga0415639_054786 3300038395 Bacteria 6600
41 Ga0415639_159443 3300038395 Bacteria 4509
42 Ga0466691_081841 3300042593 Bacteria 1270
43 Ga0466694_071052 3300042594 Bacteria 1342
44 Ga0466694_073043 3300042594 Bacteria 13969
45 Ga0466694_117606 3300042594 Bacteria 4392
46 Ga0466699_040504 3300042597 Bacteria 8134
47 Ga0466699_168404 3300042597 Bacteria 3108
48 Ga0466699_312510 3300042597 Bacteria 5155
49 Ga0466719_402155 3300042606 Bacteria 5283
50 Ga0466720_010609 3300042607 Bacteria 20996
51 Ga0466720_098454 3300042607 Unclassified 3001
52 Ga0466720_123646 3300042607 Unclassified 1586
53 AustNasuHG_c1001280 3300000089 Bacteria 9027
54 JGI24698J34947_10029198 3300002449 Bacteria 2914
55 JGI24699J35502_11113011 3300002509 Bacteria 2788
56 Ga0072941_1029687 3300005201 Bacteria 9983
57 Ga0466705_089372 3300042612 Bacteria 1846
58 Ga0466705_467541 3300042612 Bacteria 6929
59 Ga0466712_062451 3300042614 Bacteria 9485
60 Ga0466712_106746 3300042614 Bacteria 1331
61 Ga0466718_005025 3300042617 Bacteria 8528
62 Ga0123355_10024479 3300009826 Bacteria 9705
63 Ga0123355_10294541 3300009826 Bacteria 2221
64 Ga0123353_10334528 3300010167 Bacteria 2290
65 Ga0466709_015323 3300042648 Bacteria 2358
66 Ga0466709_254393 3300042648 Bacteria 1421
67 Ga0466709_284196 3300042648 Bacteria 18825
68 Ga0466709_294531 3300042648 Bacteria 3836
69 Ga0264413_127920 3300024493 Unclassified 3236
70 Ga0415639_034347 3300038395 Bacteria 4437
71 Ga0415639_211810 3300038395 Bacteria 1178
72 Ga0466692_046639 3300042591 Bacteria 23631
73 Ga0466691_202890 3300042593 Bacteria 21420
74 Ga0466694_049767 3300042594 Bacteria 2303
75 Ga0466696_334564 3300042596 Bacteria 1942
76 Ga0466699_353935 3300042597 Bacteria 1639
77 Ga0466700_417580 3300042600 Bacteria 1491
78 Ga0466720_117372 3300042607 Bacteria 29633
79 Ga0466722_096881 3300042609 Bacteria 2153
80 Ga0466722_128426 3300042609 Bacteria 5860
81 Ga0466698_498065 3300042610 Bacteria 2540
82 JGI24698J34947_10000195 3300002449 Bacteria 24539
83 JGI24698J34947_10004199 3300002449 Bacteria 7831
84 JGI24698J34947_10004874 3300002449 Bacteria 7350
85 JGI24698J34947_10012089 3300002449 Bacteria 4737
86 JGI24698J34947_10013158 3300002449 Unclassified 4521
87 JGI24698J34947_10021834 3300002449 Bacteria 3439
88 JGI24698J34947_10052010 3300002449 Bacteria 2057
89 JGI24698J34947_10074079 3300002449 Bacteria 1623
90 JGI24698J34947_10099089 3300002449 Bacteria 1315
91 JGI24702J35022_10004945 3300002462 Unclassified 7860
92 Ga0466712_002149 3300042614 Unclassified 9687
93 Ga0466712_067073 3300042614 Unclassified 1239
94 Ga0466712_133266 3300042614 Bacteria 38197
95 Ga0466712_155681 3300042614 Bacteria 1682
96 Ga0466712_188017 3300042614 Bacteria 2346
97 Ga0466712_269810 3300042614 Bacteria 2753
98 Ga0466711_274098 3300042615 Bacteria 26177
99 Ga0466718_031845 3300042617 Bacteria 2773
100 Ga0466726_299586 3300042619 Bacteria 28168
101 Ga0123356_10125674 3300010049 Bacteria 2503
102 Ga0123353_10562962 3300010167 Archaea 1640
103 Ga0123354_10068453 3300010882 Bacteria 5161
104 Ga0466703_243022 3300042636 Bacteria 15617
105 Ga0160431_101501 3300012828 Bacteria 6578
106 Ga0264413_136249 3300024493 Bacteria 1119
107 Ga0466691_193419 3300042593 Bacteria 15924
108 Ga0466699_010155 3300042597 Bacteria 15771
109 Ga0466699_047240 3300042597 Bacteria 17629
110 Ga0466699_116566 3300042597 Bacteria 14666
111 Ga0466699_137428 3300042597 Bacteria 1076
112 Ga0466699_172747 3300042597 Bacteria 4442
113 Ga0466713_003866 3300042602 Bacteria 3561
114 Ga0466719_354123 3300042606 Unclassified 1617
115 Ga0466719_441935 3300042606 Bacteria 11138
116 Ga0466720_077070 3300042607 Bacteria 14152
117 Ga0466722_052326 3300042609 Bacteria 9526
118 Ga0466698_280992 3300042610 Unclassified 1788
119 JGI24695J34938_10003637 3300002450 Bacteria 10581
120 JGI24695J34938_10038858 3300002450 Bacteria 2153
121 JGI24702J35022_10009510 3300002462 Bacteria 5451
122 Ga0072941_1062833 3300005201 Bacteria 3965
123 Ga0466705_231821 3300042612 Bacteria 3969
124 Ga0466732_079476 3300042656 Bacteria 2213
125 Ga0466705_403741 3300042612 Bacteria 3471
126 Ga0466712_062484 3300042614 Unclassified 2670
127 Ga0466712_078404 3300042614 Bacteria 1684
128 Ga0466712_135211 3300042614 Bacteria 1486
129 Ga0466712_186917 3300042614 Bacteria 2426
130 Ga0466728_074817 3300042620 Unclassified 2264
131 Ga0123356_10002756 3300010049 Bacteria 18666
132 Ga0466704_181791 3300042643 Bacteria 10950
133 Ga0466708_258511 3300042652 Bacteria 4617
134 Ga0264413_138427 3300024493 Bacteria 3587
135 Ga0415639_011147 3300038395 Bacteria 7870
136 Ga0466692_085698 3300042591 Bacteria 1528
137 Ga0466691_175486 3300042593 Bacteria 12157
138 Ga0466694_174020 3300042594 Bacteria 1635
139 Ga0466699_134283 3300042597 Bacteria 1206
140 Ga0466699_231906 3300042597 Bacteria 29115
141 Ga0466719_085376 3300042606 Bacteria 8602
142 Ga0466721_052162 3300042608 Bacteria 30809
143 JGI24698J34947_10025215 3300002449 Bacteria 3167
144 Ga0072940_1023981 3300005200 Bacteria 5130
145 Ga0072941_1012044 3300005201 Bacteria 2437
146 Ga0074263_111309 3300005485 Bacteria 1349
147 Ga0466712_230659 3300042614 Bacteria 6281
148 Ga0466711_205529 3300042615 Bacteria 7137
149 Ga0466715_176109 3300042616 Bacteria 1321
150 Ga0466718_135946 3300042617 Bacteria 1878
151 Ga0466723_250673 3300042618 Unclassified 4214
152 Ga0123357_10060098 3300009784 Bacteria 5099
153 Ga0123353_10040493 3300010167 Bacteria 7352
154 Ga0466729_265662 3300042621 Bacteria 1622
155 Ga0466703_064916 3300042636 Bacteria 8237
156 Ga0466703_173489 3300042636 Bacteria 2647
157 Ga0466708_124988 3300042652 Bacteria 3649
158 Ga0466691_137442 3300042593 Bacteria 18156
159 Ga0466694_244676 3300042594 Bacteria 4783
160 Ga0466699_200873 3300042597 Bacteria 28554
161 Ga0466716_490848 3300042605 Bacteria 3806
162 Ga0466719_005015 3300042606 Unclassified 4434
163 Ga0466720_011025 3300042607 Bacteria 8335
164 JGI24698J34947_10000475 3300002449 Bacteria 18798
165 JGI24698J34947_10006531 3300002449 Bacteria 6400
166 JGI24698J34947_10069192 3300002449 Bacteria 1704
167 Ga0072941_1012043 3300005201 Bacteria 3069
168 Ga0072941_1096525 3300005201 Bacteria 3273
169 Ga0466705_037648 3300042612 Bacteria 22325
170 Ga0466733_081070 3300042659 Bacteria 3549
171 Ga0466705_439523 3300042612 Bacteria 3462
172 Ga0466712_238195 3300042614 Bacteria 2767
173 Ga0466711_015680 3300042615 Bacteria 5849
174 Ga0466728_115806 3300042620 Bacteria 3312
175 Ga0123355_10075670 3300009826 Bacteria 5387
176 Ga0123356_10347895 3300010049 Bacteria 1605
177 Ga0123356_10371043 3300010049 Bacteria 1561
178 Ga0466731_005234 3300042622 Bacteria 1358
179 Ga0466727_251368 3300042655 Bacteria 2149
180 Ga0264413_126493 3300024493 Bacteria 2665
181 Ga0466699_072488 3300042597 Bacteria 13556
182 Ga0466699_228546 3300042597 Bacteria 2554
183 Ga0466701_078373 3300042598 Unclassified 1175
184 Ga0466716_227771 3300042605 Bacteria 1127
185 JGI24698J34947_10001949 3300002449 Bacteria 10998
186 JGI24698J34947_10073920 3300002449 Bacteria 1625
187 JGI24695J34938_10003624 3300002450 Bacteria 10610
188 Ga0466705_193049 3300042612 Bacteria 40502
189 Ga0466732_065009 3300042656 Bacteria 36157
190 Ga0466712_033007 3300042614 Bacteria 6895
191 Ga0466712_058877 3300042614 Bacteria 25182
192 Ga0466712_194278 3300042614 Unclassified 6010
193 Ga0466715_034250 3300042616 Bacteria 3152
194 Ga0466715_428846 3300042616 Bacteria 3754
195 Ga0466718_047760 3300042617 Bacteria 12577
196 Ga0466718_089500 3300042617 Bacteria 12240
197 Ga0466729_166338 3300042621 Bacteria 5905
198 Ga0123357_10021958 3300009784 Bacteria 8550
199 Ga0466729_293239 3300042621 Bacteria 9852
200 Ga0466735_026348 3300042624 Bacteria 1819
201 Ga0466704_226266 3300042643 Bacteria 6083
202 Ga0466709_152788 3300042648 Bacteria 1953
203 Ga0466692_119330 3300042591 Bacteria 10335
204 Ga0466694_053998 3300042594 Bacteria 22359
205 Ga0466694_194772 3300042594 Bacteria 6359
206 Ga0466696_018801 3300042596 Bacteria 6294
207 Ga0466696_138495 3300042596 Bacteria 15502
208 Ga0466696_164412 3300042596 Bacteria 15697
209 Ga0466699_314081 3300042597 Bacteria 17522
210 Ga0466699_316217 3300042597 Bacteria 7046
211 Ga0466722_119477 3300042609 Bacteria 1684
212 Ga0466698_246468 3300042610 Unclassified 1619
213 Ga0466698_391922 3300042610 Bacteria 1293
214 JGI24698J34947_10002270 3300002449 Bacteria 10308
215 JGI24698J34947_10019951 3300002449 Bacteria 3612
216 JGI24700J35501_10924701 3300002508 Bacteria 5556
217 Ga0068305_10093010 3300005083 Bacteria 16882
218 Ga0072941_1005108 3300005201 Bacteria 7106
219 Ga0072941_1144705 3300005201 Bacteria 2105

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 162 334 0.97
PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain 81 365 0.95
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 192 281 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02826 GO:0051287 NAD binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.