Protein Family IF06937

Metagenome Isolate
112 Members
48 Samples
104 Scaffolds
148.66 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_145348|Ga0466698_145348_12_542
Length
176 aa
Sequence
MLIITANTLTYWSHLLLYIIKFLCAEGGIAMLADTRSNYKSNREWFPSVLRGKDVVLCHTSALECLGQFPGYVNENQIDVYAKKREQYENINWYLVDGFDDMEIVNIAGLHCTSLNQTVNDMLRDYDEIDEQSLVQALADYYYENGASFDGLRIAPQHTDRFNAIKDWAVEFYIYE

📊 Sample Types

Isolate 7.1%
Metagenome 92.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 56.2%
Unclassified 18.8%
Kalotermitidae 16.7%
Termopsidae 4.2%
Rhinotermitidae 2.1%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
19 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
32 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
35 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
36 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
37 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
46 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
47 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_039548 3300042599 Bacteria 1225
2 Ga0466707_089594 3300042601 Bacteria 1572
3 Ga0466717_264292 3300042604 Bacteria 1179
4 Ga0466698_145348 3300042610 Bacteria 1312
5 Ga0466715_139448 3300042616 Bacteria 2434
6 Ga0466726_116396 3300042619 Bacteria 1907
7 Ga0466729_005503 3300042621 Bacteria 4576
8 Ga0123357_10196798 3300009784 Bacteria 2306
9 Ga0123355_10748369 3300009826 Bacteria 1106
10 Ga0123356_10046186 3300010049 Bacteria 4052
11 Ga0123353_10319152 3300010167 Bacteria 2359
12 Ga0123353_11273594 3300010167 Bacteria 957
13 JGI24702J35022_10499315 3300002462 Unclassified 746
14 Ga0072940_1552021 3300005200 Bacteria 1141
15 Ga0466725_418943 3300042654 Bacteria 2417
16 Ga0415639_028839 3300038395 Bacteria 21248
17 Ga0466693_057417 3300042592 Bacteria 1267
18 Ga0466705_019117 3300042612 Bacteria 28755
19 Ga0466707_205870 3300042601 Bacteria 1757
20 Ga0466707_343465 3300042601 Unclassified 1810
21 Ga0466714_082865 3300042603 Bacteria 2686
22 Ga0466721_313088 3300042608 Bacteria 3086
23 Ga0466712_183883 3300042614 Bacteria 2566
24 Ga0466715_045086 3300042616 Bacteria 11277
25 Ga0466715_410677 3300042616 Bacteria 3087
26 Ga0466715_462657 3300042616 Bacteria 7530
27 Ga0466723_262144 3300042618 Bacteria 17284
28 Ga0123356_10013781 3300010049 Bacteria 7785
29 Ga0123353_10173475 3300010167 Bacteria 3421
30 Ga0123353_10784313 3300010167 Bacteria 1319
31 Ga0123353_11045316 3300010167 Bacteria 1092
32 Ga0466731_174970 3300042622 Bacteria 1116
33 Ga0466703_002238 3300042636 Bacteria 1384
34 Ga0466725_296529 3300042654 Bacteria 2113
35 Ga0415639_011269 3300038395 Bacteria 12715
36 Ga0466705_280043 3300042612 Bacteria 2613
37 Ga0466707_263962 3300042601 Bacteria 1126
38 Ga0466714_022704 3300042603 Bacteria 18640
39 Ga0466716_487431 3300042605 Bacteria 3459
40 Ga0466723_049465 3300042618 Bacteria 21236
41 Ga0123356_11158823 3300010049 Bacteria 940
42 Ga0123356_11186924 3300010049 Bacteria 930
43 Ga0123353_10655170 3300010167 Bacteria 1485
44 AustNasuHG_c1002695 3300000089 Bacteria 6403
45 Ga0068302_10053146 3300005071 Bacteria 1714
46 Ga0466704_573771 3300042643 Bacteria 1171
47 Ga0466725_016065 3300042654 Bacteria 1229
48 Ga0415639_035267 3300038395 Bacteria 3978
49 Ga0415639_038861 3300038395 Bacteria 6510
50 Ga0466697_219744 3300042611 Bacteria 1619
51 Ga0466705_029384 3300042612 Bacteria 1171
52 Ga0466705_085944 3300042612 Bacteria 3333
53 Ga0466717_179610 3300042604 Bacteria 1500
54 Ga0466712_083020 3300042614 Bacteria 4935
55 Ga0466711_008582 3300042615 Bacteria 3532
56 Ga0466718_084142 3300042617 Bacteria 1387
57 Ga0123356_10321444 3300010049 Bacteria 1661
58 Ga0123356_10534783 3300010049 Bacteria 1332
59 Ga0123356_10858933 3300010049 Unclassified 1079
60 Ga0123356_10971512 3300010049 Bacteria 1020
61 Ga0123356_11743167 3300010049 Bacteria 773
62 Ga0123353_10965115 3300010167 Bacteria 1151
63 JGI24702J35022_10005313 3300002462 Bacteria 7548
64 JGI24702J35022_10110052 3300002462 Bacteria 1514
65 JGI24705J35276_11842971 3300002504 Bacteria 710
66 Ga0466657_136263 3300042582 Bacteria 1285
67 Ga0466715_542175 3300042616 Bacteria 16186
68 Ga0466715_595748 3300042616 Bacteria 1128
69 Ga0123357_10240518 3300009784 Bacteria 1961
70 Ga0123356_10613052 3300010049 Bacteria 1254
71 Ga0123353_12023656 3300010167 Bacteria 704
72 JGI24702J35022_10023518 3300002462 Bacteria 3331
73 Ga0466730_017140 3300042625 Bacteria 1278
74 Ga0466699_029907 3300042597 Bacteria 1853
75 Ga0466705_464339 3300042612 Bacteria 1264
76 Ga0466723_055188 3300042618 Bacteria 31559
77 Ga0123355_10001965 3300009826 Bacteria 29022
78 Ga0123356_10668935 3300010049 Bacteria 1206
79 Ga0123353_11253267 3300010167 Bacteria 968
80 JGI24696J40584_12296564 3300002834 Bacteria 518
81 Ga0466704_305445 3300042643 Bacteria 1646
82 Ga0466725_318455 3300042654 Bacteria 1737
83 Ga0466725_385242 3300042654 Bacteria 1966
84 Ga0415639_064983 3300038395 Bacteria 2790
85 Ga0466657_208239 3300042582 Bacteria 1118
86 Ga0466705_294386 3300042612 Bacteria 2694
87 Ga0466700_468847 3300042600 Bacteria 1432
88 Ga0466707_019333 3300042601 Unclassified 2855
89 Ga0466715_229929 3300042616 Bacteria 27115
90 Ga0123356_10245329 3300010049 Bacteria 1865
91 JGI24702J35022_10007674 3300002462 Bacteria 6164
92 JGI24702J35022_10320231 3300002462 Unclassified 920
93 Ga0466724_62235 3300042649 Bacteria 1015
94 Ga0466694_348075 3300042594 Bacteria 1517
95 Ga0466697_065790 3300042611 Bacteria 7393
96 Ga0466697_107922 3300042611 Bacteria 2498
97 Ga0466714_089896 3300042603 Bacteria 2185
98 Ga0466723_161123 3300042618 Bacteria 12317
99 Ga0123353_11731975 3300010167 Bacteria 781
100 Ga0123354_10571214 3300010882 Bacteria 842
101 Ga0466704_131167 3300042643 Bacteria 8842
102 Ga0466704_554541 3300042643 Bacteria 1627
103 Ga0466725_447215 3300042654 Bacteria 1352
104 Ga0466690_254876 3300042590 Bacteria 1014

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_179610 Ga0466717_179610_751_1182 143
2 3300042616 Ga0466715_595748 Ga0466715_595748_596_1030 144
3 3300042616 Ga0466715_542175 Ga0466715_542175_11311_11748 145
4 3300002462 JGI24702J35022_10007674 JGI24702J35022_100076749 146
5 3300038395 Ga0415639_011269 Ga0415639_011269_3584_4024 146
6 3300038395 Ga0415639_028839 Ga0415639_028839_7349_7789 146
7 3300038395 Ga0415639_035267 Ga0415639_035267_2749_3189 146
8 3300038395 Ga0415639_038861 Ga0415639_038861_5628_6068 146
9 3300042582 Ga0466657_136263 Ga0466657_136263_467_907 146
10 3300042582 Ga0466657_208239 Ga0466657_208239_393_833 146
11 3300042590 Ga0466690_254876 Ga0466690_254876_310_750 146
12 3300042592 Ga0466693_057417 Ga0466693_057417_710_1150 146
13 3300042594 Ga0466694_348075 Ga0466694_348075_221_661 146
14 3300042597 Ga0466699_029907 Ga0466699_029907_35_475 146
15 3300042600 Ga0466700_468847 Ga0466700_468847_245_685 146
16 3300042601 Ga0466707_019333 Ga0466707_019333_1023_1463 146
17 3300042601 Ga0466707_089594 Ga0466707_089594_1013_1453 146
18 3300042601 Ga0466707_343465 Ga0466707_343465_635_1075 146
19 3300042603 Ga0466714_022704 Ga0466714_022704_10078_10518 146
20 3300042603 Ga0466714_082865 Ga0466714_082865_630_1070 146
21 3300042603 Ga0466714_089896 Ga0466714_089896_841_1281 146
22 3300042604 Ga0466717_264292 Ga0466717_264292_49_489 146
23 3300042605 Ga0466716_487431 Ga0466716_487431_2148_2588 146
24 3300042611 Ga0466697_107922 Ga0466697_107922_321_761 146
25 3300042611 Ga0466697_219744 Ga0466697_219744_940_1380 146
26 3300042612 Ga0466705_019117 Ga0466705_019117_22915_23355 146
27 3300042612 Ga0466705_085944 Ga0466705_085944_1535_1975 146
28 3300042612 Ga0466705_280043 Ga0466705_280043_1856_2296 146
29 3300042612 Ga0466705_294386 Ga0466705_294386_707_1147 146
30 3300042614 Ga0466712_083020 Ga0466712_083020_3094_3534 146
31 3300042614 Ga0466712_183883 Ga0466712_183883_257_697 146
32 3300042615 Ga0466711_008582 Ga0466711_008582_1416_1856 146
33 3300042616 Ga0466715_045086 Ga0466715_045086_9784_10224 146
34 3300042616 Ga0466715_139448 Ga0466715_139448_705_1145 146
35 3300042616 Ga0466715_229929 Ga0466715_229929_14667_15107 146
36 3300042616 Ga0466715_410677 Ga0466715_410677_2128_2568 146
37 3300042616 Ga0466715_462657 Ga0466715_462657_2894_3334 146
38 3300042617 Ga0466718_084142 Ga0466718_084142_168_608 146
39 3300042618 Ga0466723_049465 Ga0466723_049465_20510_20950 146
40 3300042618 Ga0466723_161123 Ga0466723_161123_11775_12215 146
41 3300042618 Ga0466723_262144 Ga0466723_262144_15457_15897 146
42 3300042619 Ga0466726_116396 Ga0466726_116396_971_1411 146
43 3300042622 Ga0466731_174970 Ga0466731_174970_391_831 146
44 3300042625 Ga0466730_017140 Ga0466730_017140_686_1126 146
45 3300042636 Ga0466703_002238 Ga0466703_002238_74_514 146
46 3300042643 Ga0466704_305445 Ga0466704_305445_1025_1465 146
47 3300042643 Ga0466704_554541 Ga0466704_554541_402_842 146
48 3300042643 Ga0466704_573771 Ga0466704_573771_214_654 146
49 3300042649 Ga0466724_62235 Ga0466724_62235_562_1002 146
50 3300042654 Ga0466725_016065 Ga0466725_016065_522_962 146
51 3300042654 Ga0466725_318455 Ga0466725_318455_352_792 146
52 3300042654 Ga0466725_385242 Ga0466725_385242_829_1269 146
53 3300042654 Ga0466725_418943 Ga0466725_418943_1078_1518 146
54 3300042654 Ga0466725_447215 Ga0466725_447215_478_918 146
55 iso_pr_bacteria 2820238527 2820240351 146
56 iso_pr_bacteria 2820246658 2820248166 146
57 iso_pr_bacteria 2820267566 2820271031 146
58 iso_pr_bacteria 2820292184 2820293959 146
59 iso_pr_bacteria 2820641689 2820642789 146
60 iso_pr_bacteria 2820647881 2820648638 146
61 3300002462 JGI24702J35022_10005313 JGI24702J35022_100053138 147
62 3300002462 JGI24702J35022_10023518 JGI24702J35022_100235181 147
63 3300002462 JGI24702J35022_10110052 JGI24702J35022_101100521 147
64 3300002462 JGI24702J35022_10320231 JGI24702J35022_103202311 147
65 3300002462 JGI24702J35022_10499315 JGI24702J35022_104993152 147
66 3300002504 JGI24705J35276_11842971 JGI24705J35276_118429711 147
67 3300002834 JGI24696J40584_12296564 JGI24696J40584_122965641 147
68 3300005071 Ga0068302_10053146 Ga0068302_100531461 147
69 3300009784 Ga0123357_10196798 Ga0123357_101967984 147
70 3300009784 Ga0123357_10240518 Ga0123357_102405182 147
71 3300009826 Ga0123355_10748369 Ga0123355_107483692 147
72 3300010049 Ga0123356_10013781 Ga0123356_100137818 147
73 3300010049 Ga0123356_10046186 Ga0123356_100461866 147
74 3300010049 Ga0123356_10245329 Ga0123356_102453292 147
75 3300010049 Ga0123356_10534783 Ga0123356_105347831 147
76 3300010049 Ga0123356_10668935 Ga0123356_106689351 147
77 3300010049 Ga0123356_11158823 Ga0123356_111588232 147
78 3300010049 Ga0123356_11743167 Ga0123356_117431672 147
79 3300010167 Ga0123353_10173475 Ga0123353_101734752 147
80 3300010167 Ga0123353_10319152 Ga0123353_103191523 147
81 3300010167 Ga0123353_10655170 Ga0123353_106551702 147
82 3300010167 Ga0123353_10784313 Ga0123353_107843131 147
83 3300010167 Ga0123353_10965115 Ga0123353_109651151 147
84 3300010167 Ga0123353_11045316 Ga0123353_110453162 147
85 3300010167 Ga0123353_11253267 Ga0123353_112532672 147
86 3300010167 Ga0123353_11273594 Ga0123353_112735942 147
87 3300010167 Ga0123353_12023656 Ga0123353_120236561 147
88 3300042654 Ga0466725_296529 Ga0466725_296529_291_734 147
89 iso_pr_bacteria 2820630457 2820631664 147
90 3300009826 Ga0123355_10001965 Ga0123355_100019659 148
91 3300042611 Ga0466697_065790 Ga0466697_065790_3818_4264 148
92 3300010049 Ga0123356_10858933 Ga0123356_108589331 149
93 3300000089 AustNasuHG_c1002695 AustNasuHG_10026953 150
94 3300042621 Ga0466729_005503 Ga0466729_005503_3471_3923 150
95 3300042599 Ga0466706_039548 Ga0466706_039548_625_1086 153
96 iso_pr_bacteria 2820280018 2820280401 153
97 3300042601 Ga0466707_205870 Ga0466707_205870_443_907 154
98 3300042612 Ga0466705_029384 Ga0466705_029384_261_725 154
99 3300042612 Ga0466705_464339 Ga0466705_464339_213_677 154
100 3300010167 Ga0123353_11731975 Ga0123353_117319751 156
101 3300042608 Ga0466721_313088 Ga0466721_313088_2350_2820 156
102 3300042618 Ga0466723_055188 Ga0466723_055188_685_1158 157
103 3300010049 Ga0123356_11186924 Ga0123356_111869242 158
104 3300042643 Ga0466704_131167 Ga0466704_131167_472_951 159
105 3300010049 Ga0123356_10613052 Ga0123356_106130522 160
106 3300042601 Ga0466707_263962 Ga0466707_263962_472_954 160
107 3300005200 Ga0072940_1552021 Ga0072940_15520211 163
108 3300010049 Ga0123356_10321444 Ga0123356_103214441 165
109 3300010882 Ga0123354_10571214 Ga0123354_105712142 167
110 3300038395 Ga0415639_064983 Ga0415639_064983_61_573 170
111 3300010049 Ga0123356_10971512 Ga0123356_109715122 173
112 3300042610 Ga0466698_145348 Ga0466698_145348_12_542 176

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.