Protein Family IF06936
Metagenome
Isolate
140
Members
58
Samples
128
Scaffolds
128.12
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_144115|Ga0466698_144115_1065_1475
- Length
- 136 aa
- Sequence
- MPLMHAQYGMNYLLDTHTALWALEDKTHLSGKAQAIIDDVSQHLLISVISAWEIAIKISVGKLNFTGGSRVFLEKMRKNGIDILNIEKAYINIIESLPFHHRDPFDRMLVATAIAENLTILTADEDIRKYNVTVVW
Sample Types
Isolate
8.6%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.4%
Unclassified
26.3%
Kalotermitidae
17.5%
Rhinotermitidae
3.5%
Hodotermitidae
1.8%
Formicidae
1.8%
Termopsidae
1.8%
Taxonomy
Archaea
2
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 2 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 15 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 16 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 35 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 48 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 49 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 54 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 55 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 56 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 57 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_123787 | 3300042611 | Bacteria | 1736 |
| 2 | Ga0466707_292049 | 3300042601 | Bacteria | 3754 |
| 3 | Ga0466717_022856 | 3300042604 | Bacteria | 1534 |
| 4 | Ga0466717_093093 | 3300042604 | Bacteria | 1719 |
| 5 | Ga0466717_259637 | 3300042604 | Bacteria | 14859 |
| 6 | Ga0466719_014527 | 3300042606 | Bacteria | 1054 |
| 7 | Ga0466719_441083 | 3300042606 | Bacteria | 2444 |
| 8 | Ga0466726_190819 | 3300042619 | Bacteria | 4750 |
| 9 | Ga0123355_10089215 | 3300009826 | Bacteria | 4894 |
| 10 | Ga0123353_11863117 | 3300010167 | Bacteria | 744 |
| 11 | Ga0264413_144170 | 3300024493 | Bacteria | 7949 |
| 12 | Ga0466695_081112 | 3300042595 | Bacteria | 1237 |
| 13 | Ga0466695_139849 | 3300042595 | Bacteria | 1764 |
| 14 | JGI24695J34938_10108445 | 3300002450 | Bacteria | 1132 |
| 15 | Ga0466731_282759 | 3300042622 | Unclassified | 2144 |
| 16 | Ga0466708_185396 | 3300042652 | Bacteria | 2268 |
| 17 | Ga0466705_104507 | 3300042612 | Bacteria | 37603 |
| 18 | Ga0466700_462483 | 3300042600 | Unclassified | 2090 |
| 19 | Ga0466713_102360 | 3300042602 | Bacteria | 6258 |
| 20 | Ga0466722_010542 | 3300042609 | Bacteria | 2977 |
| 21 | Ga0466698_144115 | 3300042610 | Bacteria | 1487 |
| 22 | Ga0123357_10374603 | 3300009784 | Bacteria | 1329 |
| 23 | Ga0123356_10520408 | 3300010049 | Bacteria | 1348 |
| 24 | Ga0123356_11581175 | 3300010049 | Bacteria | 811 |
| 25 | Ga0123353_10058530 | 3300010167 | Bacteria | 6175 |
| 26 | Ga0123353_10579604 | 3300010167 | Bacteria | 1610 |
| 27 | Ga0123353_10645851 | 3300010167 | Bacteria | 1499 |
| 28 | Ga0415639_037857 | 3300038395 | Bacteria | 7960 |
| 29 | Ga0415639_119793 | 3300038395 | Unclassified | 2740 |
| 30 | Ga0466696_147459 | 3300042596 | Bacteria | 22585 |
| 31 | Ga0466699_179495 | 3300042597 | Bacteria | 2156 |
| 32 | JGI24695J34938_10139402 | 3300002450 | Bacteria | 990 |
| 33 | JGI24696J40584_12344293 | 3300002834 | Bacteria | 534 |
| 34 | JGI24696J40584_12826273 | 3300002834 | Bacteria | 919 |
| 35 | Ga0068305_10051974 | 3300005083 | Bacteria | 2770 |
| 36 | Ga0466733_101558 | 3300042659 | Bacteria | 2233 |
| 37 | Ga0466706_210713 | 3300042599 | Bacteria | 1357 |
| 38 | Ga0466717_170914 | 3300042604 | Archaea | 4923 |
| 39 | Ga0466718_129333 | 3300042617 | Bacteria | 1106 |
| 40 | Ga0123355_10000927 | 3300009826 | Bacteria | 40540 |
| 41 | Ga0123356_10551704 | 3300010049 | Bacteria | 1313 |
| 42 | Ga0123356_11362998 | 3300010049 | Unclassified | 871 |
| 43 | Ga0123353_10562436 | 3300010167 | Bacteria | 1641 |
| 44 | Ga0123353_11724423 | 3300010167 | Bacteria | 783 |
| 45 | Ga0415639_021716 | 3300038395 | Unclassified | 3132 |
| 46 | Ga0415639_077752 | 3300038395 | Bacteria | 1088 |
| 47 | Ga0466694_033147 | 3300042594 | Bacteria | 3853 |
| 48 | JGI24703J35330_11678171 | 3300002501 | Bacteria | 1786 |
| 49 | JGI24696J40584_12817942 | 3300002834 | Bacteria | 902 |
| 50 | Ga0466704_414220 | 3300042643 | Bacteria | 40291 |
| 51 | Ga0466721_004294 | 3300042608 | Bacteria | 1369 |
| 52 | Ga0466698_435467 | 3300042610 | Bacteria | 1752 |
| 53 | Ga0466715_240467 | 3300042616 | Bacteria | 9454 |
| 54 | Ga0466715_643651 | 3300042616 | Bacteria | 1745 |
| 55 | Ga0466726_129897 | 3300042619 | Bacteria | 1216 |
| 56 | Ga0466726_134772 | 3300042619 | Bacteria | 1027 |
| 57 | Ga0466726_192279 | 3300042619 | Bacteria | 1816 |
| 58 | Ga0123357_10807563 | 3300009784 | Unclassified | 633 |
| 59 | Ga0123356_10426538 | 3300010049 | Bacteria | 1469 |
| 60 | Ga0123356_13630805 | 3300010049 | Unclassified | 534 |
| 61 | Ga0123356_13997844 | 3300010049 | Unclassified | 508 |
| 62 | Ga0123353_13415937 | 3300010167 | Unclassified | 503 |
| 63 | Ga0466657_141024 | 3300042582 | Bacteria | 2314 |
| 64 | Ga0466699_148995 | 3300042597 | Bacteria | 1523 |
| 65 | Ga0072940_1205373 | 3300005200 | Bacteria | 2593 |
| 66 | Ga0466731_184782 | 3300042622 | Bacteria | 1029 |
| 67 | Ga0466706_209795 | 3300042599 | Bacteria | 2647 |
| 68 | Ga0466721_029196 | 3300042608 | Bacteria | 1285 |
| 69 | Ga0466726_456649 | 3300042619 | Bacteria | 1906 |
| 70 | Ga0123357_10116723 | 3300009784 | Unclassified | 3379 |
| 71 | Ga0123355_10166859 | 3300009826 | Bacteria | 3301 |
| 72 | Ga0123356_12114216 | 3300010049 | Unclassified | 703 |
| 73 | Ga0123353_11215997 | 3300010167 | Bacteria | 987 |
| 74 | Ga0466695_064481 | 3300042595 | Bacteria | 1171 |
| 75 | Ga0466695_112792 | 3300042595 | Unclassified | 1461 |
| 76 | JGI24705J35276_12211373 | 3300002504 | Bacteria | 1854 |
| 77 | JGI24705J35276_12222522 | 3300002504 | Bacteria | 2427 |
| 78 | JGI24705J35276_12235907 | 3300002504 | Unclassified | 7147 |
| 79 | Ga0068305_10092030 | 3300005083 | Bacteria | 4190 |
| 80 | Ga0466703_203526 | 3300042636 | Bacteria | 1317 |
| 81 | Ga0466706_289334 | 3300042599 | Bacteria | 5898 |
| 82 | Ga0466714_007945 | 3300042603 | Bacteria | 1774 |
| 83 | Ga0466719_380127 | 3300042606 | Bacteria | 1866 |
| 84 | Ga0123353_10119741 | 3300010167 | Bacteria | 4233 |
| 85 | Ga0466690_236202 | 3300042590 | Bacteria | 1551 |
| 86 | Ga0466692_063886 | 3300042591 | Bacteria | 6701 |
| 87 | Ga0466693_407273 | 3300042592 | Bacteria | 1771 |
| 88 | Ga0466695_374636 | 3300042595 | Bacteria | 1063 |
| 89 | JGI24705J35276_12220073 | 3300002504 | Bacteria | 2243 |
| 90 | Ga0466731_117917 | 3300042622 | Bacteria | 1313 |
| 91 | Ga0466725_124827 | 3300042654 | Bacteria | 1951 |
| 92 | Ga0466706_154792 | 3300042599 | Bacteria | 1155 |
| 93 | Ga0466722_138052 | 3300042609 | Bacteria | 1653 |
| 94 | Ga0466711_507265 | 3300042615 | Bacteria | 2522 |
| 95 | Ga0466715_532714 | 3300042616 | Bacteria | 8078 |
| 96 | Ga0123355_10610282 | 3300009826 | Bacteria | 1291 |
| 97 | Ga0123356_10000225 | 3300010049 | Bacteria | 65755 |
| 98 | Ga0123353_10169415 | 3300010167 | Bacteria | 3468 |
| 99 | Ga0123353_10831064 | 3300010167 | Bacteria | 1270 |
| 100 | Ga0123354_10000019 | 3300010882 | Bacteria | 128383 |
| 101 | JGI24695J34938_10031870 | 3300002450 | Bacteria | 2441 |
| 102 | Ga0102735_1000032 | 3300007080 | Bacteria | 90626 |
| 103 | Ga0466709_294530 | 3300042648 | Unclassified | 1148 |
| 104 | Ga0466708_379932 | 3300042652 | Bacteria | 1022 |
| 105 | Ga0466713_006243 | 3300042602 | Bacteria | 73153 |
| 106 | Ga0466722_196677 | 3300042609 | Bacteria | 2819 |
| 107 | Ga0466715_015883 | 3300042616 | Bacteria | 4037 |
| 108 | Ga0466715_231680 | 3300042616 | Bacteria | 1438 |
| 109 | Ga0123355_10725667 | 3300009826 | Bacteria | 1132 |
| 110 | Ga0123356_12382843 | 3300010049 | Bacteria | 662 |
| 111 | Ga0123356_12385768 | 3300010049 | Bacteria | 662 |
| 112 | Ga0123356_12449614 | 3300010049 | Unclassified | 653 |
| 113 | Ga0123353_10000146 | 3300010167 | Bacteria | 87435 |
| 114 | Ga0123353_10044942 | 3300010167 | Bacteria | 7005 |
| 115 | Ga0123353_10285689 | 3300010167 | Bacteria | 2530 |
| 116 | Ga0123353_10879369 | 3300010167 | Bacteria | 1223 |
| 117 | Ga0123353_10988953 | 3300010167 | Bacteria | 1132 |
| 118 | Ga0123353_11382865 | 3300010167 | Unclassified | 906 |
| 119 | Ga0123353_11710165 | 3300010167 | Bacteria | 787 |
| 120 | Ga0123353_11878200 | 3300010167 | Bacteria | 740 |
| 121 | Ga0123353_12003550 | 3300010167 | Archaea | 709 |
| 122 | Ga0123354_10249019 | 3300010882 | Unclassified | 1806 |
| 123 | Ga0123354_10488753 | 3300010882 | Bacteria | 968 |
| 124 | JGI24702J35022_10048384 | 3300002462 | Bacteria | 2263 |
| 125 | JGI24703J35330_11744387 | 3300002501 | Bacteria | 4170 |
| 126 | JGI24696J40584_12689275 | 3300002834 | Unclassified | 727 |
| 127 | Ga0068305_10405898 | 3300005083 | Bacteria | 1386 |
| 128 | Ga0466703_199305 | 3300042636 | Bacteria | 2578 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 12 | 130 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.