Protein Family IF06926
Metagenome
Isolate
114
Members
55
Samples
104
Scaffolds
271.37
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_035239|Ga0466698_035239_294_1250
- Length
- 318 aa
- Sequence
- LTARQLGEENFLHSRFDASSAFEFALTANSVTIDEHYFSPTMYMLKSAREIDRMRKAGLYVWHALQIAEALCQPGVTTGKIDAQIEQFFNDHHVLPLFKGVPGVVPFPAVTCISVNEQVVHGIPGNRVLQEGDIVGIDTGCKILDPGLQTKGWCGDAAQTFAVGKITEEQQRLLDVTDGMLTIAIEEMGKAATWSAVARKMQTLAHKNNFFVIEDLVGHGIGREMHEAPQVPNYVSQQTLRTDFKLVPGMVIAVEPMVNVGTKQIRTLRDHWTIVTKDHKPSAHFEHTLALTASGVRVLTGPPENDAERIDISKYVTV
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.0%
Kalotermitidae
24.1%
Unclassified
18.5%
Armadillidiidae
5.6%
Rhinotermitidae
3.7%
Termopsidae
3.7%
Passalidae
1.9%
Curculionidae
1.9%
Formicidae
1.9%
Scarabaeidae
1.9%
Taxonomy
Archaea
0
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 21 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 22 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 23 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 24 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 25 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 34 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 35 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 46 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 47 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 50 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10601775 | 3300010049 | Unclassified | 1264 |
| 2 | Ga0123353_10000824 | 3300010167 | Bacteria | 37743 |
| 3 | Ga0123353_10063205 | 3300010167 | Bacteria | 5938 |
| 4 | Ga0123353_10084671 | 3300010167 | Unclassified | 5104 |
| 5 | Ga0123353_10089606 | 3300010167 | Bacteria | 4953 |
| 6 | Ga0160444_100116 | 3300012841 | Bacteria | 83971 |
| 7 | Ga0466716_140834 | 3300042605 | Bacteria | 166440 |
| 8 | Ga0466719_576846 | 3300042606 | Bacteria | 5497 |
| 9 | Ga0466698_035239 | 3300042610 | Bacteria | 1311 |
| 10 | Ga0466723_045655 | 3300042618 | Bacteria | 148423 |
| 11 | Ga0063521_1000388 | 3300003973 | Bacteria | 24855 |
| 12 | Ga0466734_149029 | 3300042623 | Bacteria | 1396 |
| 13 | Ga0466702_422645 | 3300042635 | Bacteria | 1860 |
| 14 | Ga0466703_183187 | 3300042636 | Bacteria | 6190 |
| 15 | Ga0466708_105321 | 3300042652 | Bacteria | 23379 |
| 16 | Ga0466708_367339 | 3300042652 | Bacteria | 21747 |
| 17 | Ga0123356_10408824 | 3300010049 | Bacteria | 1496 |
| 18 | Ga0123356_10588002 | 3300010049 | Bacteria | 1277 |
| 19 | Ga0123353_10007030 | 3300010167 | Bacteria | 15135 |
| 20 | Ga0123354_10012254 | 3300010882 | Bacteria | 13287 |
| 21 | Ga0466700_436645 | 3300042600 | Bacteria | 1944 |
| 22 | Ga0466729_146126 | 3300042621 | Bacteria | 3445 |
| 23 | Ga0466704_127781 | 3300042643 | Bacteria | 1633 |
| 24 | Ga0466727_178271 | 3300042655 | Bacteria | 5244 |
| 25 | Ga0123356_10072731 | 3300010049 | Bacteria | 3231 |
| 26 | Ga0123353_10027397 | 3300010167 | Unclassified | 8731 |
| 27 | Ga0466707_020662 | 3300042601 | Bacteria | 3109 |
| 28 | Ga0466707_141064 | 3300042601 | Bacteria | 19817 |
| 29 | Ga0466714_124658 | 3300042603 | Bacteria | 3306 |
| 30 | Ga0466698_111014 | 3300042610 | Bacteria | 1225 |
| 31 | Ga0466709_406658 | 3300042648 | Bacteria | 1718 |
| 32 | Ga0123353_10027345 | 3300010167 | Bacteria | 8739 |
| 33 | Ga0123353_10265201 | 3300010167 | Bacteria | 2650 |
| 34 | Ga0160455_103877 | 3300012837 | Bacteria | 2055 |
| 35 | Ga0466690_017855 | 3300042590 | Bacteria | 16704 |
| 36 | Ga0466691_199487 | 3300042593 | Bacteria | 168397 |
| 37 | Ga0466717_106885 | 3300042604 | Unclassified | 1234 |
| 38 | Ga0466698_136355 | 3300042610 | Bacteria | 4112 |
| 39 | Ga0466711_303119 | 3300042615 | Bacteria | 30132 |
| 40 | Ga0466711_353449 | 3300042615 | Bacteria | 8615 |
| 41 | Ga0466715_009191 | 3300042616 | Bacteria | 11996 |
| 42 | JGI24702J35022_10026036 | 3300002462 | Bacteria | 3154 |
| 43 | Ga0466733_193988 | 3300042659 | Bacteria | 1686 |
| 44 | Ga0466703_368547 | 3300042636 | Bacteria | 13848 |
| 45 | Ga0123355_10371092 | 3300009826 | Bacteria | 1874 |
| 46 | Ga0123356_10969752 | 3300010049 | Bacteria | 1021 |
| 47 | Ga0123353_10212144 | 3300010167 | Bacteria | 3036 |
| 48 | Ga0466690_158113 | 3300042590 | Bacteria | 11918 |
| 49 | Ga0466692_186287 | 3300042591 | Bacteria | 4128 |
| 50 | Ga0466696_037048 | 3300042596 | Bacteria | 24718 |
| 51 | Ga0466696_148402 | 3300042596 | Bacteria | 10906 |
| 52 | Ga0466707_186675 | 3300042601 | Bacteria | 4055 |
| 53 | Ga0466717_138251 | 3300042604 | Bacteria | 1148 |
| 54 | Ga0466726_152289 | 3300042619 | Bacteria | 2424 |
| 55 | CVPL010L_1000090 | 3300002932 | Bacteria | 56201 |
| 56 | Ga0072940_1130196 | 3300005200 | Bacteria | 1714 |
| 57 | Ga0466705_155484 | 3300042612 | Bacteria | 6554 |
| 58 | Ga0466729_281099 | 3300042621 | Bacteria | 22845 |
| 59 | Ga0160468_103973 | 3300012819 | Unclassified | 1881 |
| 60 | Ga0415639_206948 | 3300038395 | Bacteria | 1167 |
| 61 | Ga0466690_159140 | 3300042590 | Bacteria | 4931 |
| 62 | Ga0466695_080339 | 3300042595 | Unclassified | 1118 |
| 63 | Ga0466695_292806 | 3300042595 | Bacteria | 3045 |
| 64 | Ga0466716_332395 | 3300042605 | Bacteria | 10976 |
| 65 | Ga0466719_073536 | 3300042606 | Unclassified | 6970 |
| 66 | Ga0466719_077504 | 3300042606 | Bacteria | 6970 |
| 67 | Ga0466698_372509 | 3300042610 | Bacteria | 4225 |
| 68 | Ga0466715_040462 | 3300042616 | Bacteria | 20601 |
| 69 | Ga0466729_194543 | 3300042621 | Bacteria | 2520 |
| 70 | JGI24695J34938_10026391 | 3300002450 | Bacteria | 2761 |
| 71 | Ga0072940_1058777 | 3300005200 | Bacteria | 3040 |
| 72 | Ga0466703_408780 | 3300042636 | Bacteria | 2328 |
| 73 | Ga0123356_10046808 | 3300010049 | Bacteria | 4025 |
| 74 | Ga0123356_10621810 | 3300010049 | Unclassified | 1246 |
| 75 | Ga0123353_10007708 | 3300010167 | Bacteria | 14600 |
| 76 | Ga0123353_10116197 | 3300010167 | Bacteria | 4305 |
| 77 | Ga0466690_012063 | 3300042590 | Bacteria | 1897 |
| 78 | Ga0466692_183181 | 3300042591 | Bacteria | 8881 |
| 79 | Ga0466693_165563 | 3300042592 | Bacteria | 1631 |
| 80 | Ga0466696_023283 | 3300042596 | Bacteria | 149582 |
| 81 | Ga0466696_090409 | 3300042596 | Bacteria | 4394 |
| 82 | Ga0466700_087899 | 3300042600 | Bacteria | 3902 |
| 83 | Ga0466700_367273 | 3300042600 | Bacteria | 1254 |
| 84 | JGI24702J35022_10056260 | 3300002462 | Bacteria | 2098 |
| 85 | Ga0072941_1120222 | 3300005201 | Bacteria | 2558 |
| 86 | Ga0072941_1132357 | 3300005201 | Bacteria | 3745 |
| 87 | Ga0466730_031476 | 3300042625 | Bacteria | 228189 |
| 88 | Ga0466703_077483 | 3300042636 | Unclassified | 7969 |
| 89 | Ga0466704_128307 | 3300042643 | Bacteria | 102387 |
| 90 | Ga0123353_10017272 | 3300010167 | Bacteria | 10596 |
| 91 | Ga0123353_10111981 | 3300010167 | Bacteria | 4395 |
| 92 | Ga0123353_10115657 | 3300010167 | Bacteria | 4317 |
| 93 | Ga0123353_10116424 | 3300010167 | Bacteria | 4301 |
| 94 | Ga0466707_221345 | 3300042601 | Bacteria | 6209 |
| 95 | Ga0466707_335911 | 3300042601 | Bacteria | 1212 |
| 96 | Ga0466719_471494 | 3300042606 | Bacteria | 23771 |
| 97 | Ga0466711_011735 | 3300042615 | Bacteria | 27241 |
| 98 | Ga0466715_289831 | 3300042616 | Bacteria | 4251 |
| 99 | Ga0466718_153169 | 3300042617 | Bacteria | 5239 |
| 100 | Ga0466723_078213 | 3300042618 | Bacteria | 19238 |
| 101 | 2227581032 | 2225789004 | Bacteria | 2511 |
| 102 | JGI24695J34938_10061057 | 3300002450 | Bacteria | 1606 |
| 103 | JGI24702J35022_10065416 | 3300002462 | Bacteria | 1950 |
| 104 | JGI24696J40584_12945158 | 3300002834 | Bacteria | 1840 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00557 | Peptidase_M24 | Metallopeptidase family M24 | 53 | 292 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.