Protein Family IF06919
Metagenome
Isolate
154
Members
43
Samples
151
Scaffolds
298.82
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_266365|Ga0466722_266365_3974_5032
- Length
- 352 aa
- Sequence
- MRYSCRQDLFNKAALKRTSVRARRAKNCKSLCESNRLLQQALDYSVLPWEEEMKAKRIQGTAVRLTAGDRVFYALLDIFLVLXXXXVAVPMWSTITLSFRSNTFIGSNLEGMFLPPWKWSAAAYRALLGNSGFLNAFFNSLKIFVFGVASALFLTIPLAYVLSVRTLPGRKFLNVFILIPYLFNVGLIPSYLVVNRLGLSNHLAAIFLPAAISTYNCLIMRGFFEGIPDELKESARIDGAPEITVLLRIIIPLSKPIIMTIGLYYGVQFWNDFFHAMLYINNNALQPLPILLRNILMATGMNEFVEVSAFGEAPVQAIKAASVFMAAIPMIIAYPFIQKYFTKGTLLGSVKG
Sample Types
Isolate
1.9%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.9%
Kalotermitidae
31.7%
Rhinotermitidae
9.8%
Unclassified
7.3%
Termopsidae
7.3%
Taxonomy
Archaea
0
Bacteria
144
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10113674 | 3300002449 | Bacteria | 1189 |
| 2 | Ga0264413_129109 | 3300024493 | Bacteria | 4224 |
| 3 | Ga0466690_040836 | 3300042590 | Bacteria | 3620 |
| 4 | Ga0466690_073261 | 3300042590 | Bacteria | 5050 |
| 5 | Ga0466690_148172 | 3300042590 | Bacteria | 1098 |
| 6 | Ga0466696_007503 | 3300042596 | Bacteria | 10728 |
| 7 | Ga0466696_224532 | 3300042596 | Bacteria | 9727 |
| 8 | Ga0466696_307974 | 3300042596 | Bacteria | 34055 |
| 9 | Ga0466704_479716 | 3300042643 | Bacteria | 8080 |
| 10 | Ga0466727_014358 | 3300042655 | Bacteria | 1430 |
| 11 | Ga0123356_10021945 | 3300010049 | Bacteria | 6029 |
| 12 | Ga0466707_344548 | 3300042601 | Bacteria | 1430 |
| 13 | Ga0466722_175899 | 3300042609 | Bacteria | 3869 |
| 14 | Ga0466722_197142 | 3300042609 | Bacteria | 8548 |
| 15 | Ga0466715_238123 | 3300042616 | Bacteria | 9038 |
| 16 | Ga0466723_168978 | 3300042618 | Bacteria | 11427 |
| 17 | Ga0466723_285704 | 3300042618 | Bacteria | 3365 |
| 18 | Ga0466726_137503 | 3300042619 | Bacteria | 1228 |
| 19 | Ga0466728_244014 | 3300042620 | Bacteria | 12713 |
| 20 | Ga0466729_025386 | 3300042621 | Bacteria | 1599 |
| 21 | Ga0466705_048665 | 3300042612 | Bacteria | 8142 |
| 22 | AustNasuHG_c1001273 | 3300000089 | Bacteria | 9064 |
| 23 | Ga0466690_390620 | 3300042590 | Bacteria | 26148 |
| 24 | Ga0466691_198638 | 3300042593 | Bacteria | 3076 |
| 25 | Ga0466696_090401 | 3300042596 | Bacteria | 10101 |
| 26 | Ga0466696_188752 | 3300042596 | Bacteria | 12694 |
| 27 | Ga0466699_413953 | 3300042597 | Bacteria | 1027 |
| 28 | Ga0466704_263674 | 3300042643 | Bacteria | 3889 |
| 29 | Ga0466704_387584 | 3300042643 | Bacteria | 5497 |
| 30 | Ga0466707_338338 | 3300042601 | Bacteria | 1277 |
| 31 | Ga0466714_146583 | 3300042603 | Bacteria | 1648 |
| 32 | Ga0466719_476167 | 3300042606 | Bacteria | 2442 |
| 33 | Ga0466722_166522 | 3300042609 | Bacteria | 7319 |
| 34 | Ga0466715_460929 | 3300042616 | Bacteria | 18133 |
| 35 | Ga0466715_494209 | 3300042616 | Bacteria | 17849 |
| 36 | Ga0466718_097298 | 3300042617 | Bacteria | 24857 |
| 37 | Ga0466705_126222 | 3300042612 | Bacteria | 8501 |
| 38 | Ga0466705_321928 | 3300042612 | Bacteria | 28342 |
| 39 | JGI24702J35022_10002316 | 3300002462 | Bacteria | 11661 |
| 40 | Ga0072941_1059593 | 3300005201 | Bacteria | 24866 |
| 41 | Ga0466690_012256 | 3300042590 | Bacteria | 3296 |
| 42 | Ga0466690_110981 | 3300042590 | Unclassified | 2928 |
| 43 | Ga0466692_007906 | 3300042591 | Bacteria | 2827 |
| 44 | Ga0466691_079092 | 3300042593 | Bacteria | 17061 |
| 45 | Ga0466735_112823 | 3300042624 | Bacteria | 3202 |
| 46 | Ga0466703_087443 | 3300042636 | Bacteria | 4567 |
| 47 | Ga0466703_097372 | 3300042636 | Bacteria | 4108 |
| 48 | Ga0466704_033321 | 3300042643 | Bacteria | 22698 |
| 49 | Ga0466704_045523 | 3300042643 | Bacteria | 14134 |
| 50 | Ga0466709_216249 | 3300042648 | Bacteria | 16336 |
| 51 | Ga0466719_301447 | 3300042606 | Bacteria | 7708 |
| 52 | Ga0466698_433879 | 3300042610 | Bacteria | 1914 |
| 53 | Ga0466715_016671 | 3300042616 | Bacteria | 5817 |
| 54 | Ga0466715_321233 | 3300042616 | Bacteria | 2661 |
| 55 | Ga0466723_337292 | 3300042618 | Bacteria | 4769 |
| 56 | Ga0466726_287535 | 3300042619 | Bacteria | 15444 |
| 57 | Ga0466705_001436 | 3300042612 | Bacteria | 17855 |
| 58 | Ga0466705_086011 | 3300042612 | Bacteria | 10166 |
| 59 | Ga0466733_200220 | 3300042659 | Bacteria | 1607 |
| 60 | JGI24695J34938_10004971 | 3300002450 | Bacteria | 8484 |
| 61 | JGI24702J35022_10032062 | 3300002462 | Bacteria | 2814 |
| 62 | Ga0415639_010394 | 3300038395 | Bacteria | 11605 |
| 63 | Ga0466690_214071 | 3300042590 | Bacteria | 16418 |
| 64 | Ga0466692_066278 | 3300042591 | Bacteria | 3508 |
| 65 | Ga0466692_143855 | 3300042591 | Bacteria | 4958 |
| 66 | Ga0466692_158720 | 3300042591 | Bacteria | 9049 |
| 67 | Ga0466696_173354 | 3300042596 | Bacteria | 2691 |
| 68 | Ga0466703_098927 | 3300042636 | Bacteria | 24801 |
| 69 | Ga0466709_302691 | 3300042648 | Bacteria | 3114 |
| 70 | Ga0123354_10130109 | 3300010882 | Bacteria | 3185 |
| 71 | Ga0466707_096252 | 3300042601 | Bacteria | 1401 |
| 72 | Ga0466705_414425 | 3300042612 | Bacteria | 11317 |
| 73 | Ga0466726_388923 | 3300042619 | Bacteria | 2247 |
| 74 | Ga0466728_372826 | 3300042620 | Bacteria | 1522 |
| 75 | Ga0466733_208167 | 3300042659 | Bacteria | 31218 |
| 76 | JGI24695J34938_10055692 | 3300002450 | Unclassified | 1708 |
| 77 | Ga0466696_043605 | 3300042596 | Unclassified | 2761 |
| 78 | Ga0466735_036027 | 3300042624 | Bacteria | 2247 |
| 79 | Ga0466704_021379 | 3300042643 | Bacteria | 2605 |
| 80 | Ga0466704_279924 | 3300042643 | Bacteria | 14891 |
| 81 | Ga0466709_178541 | 3300042648 | Bacteria | 10415 |
| 82 | Ga0466727_217448 | 3300042655 | Bacteria | 4917 |
| 83 | Ga0123357_10042466 | 3300009784 | Bacteria | 6183 |
| 84 | Ga0466722_208570 | 3300042609 | Bacteria | 1924 |
| 85 | Ga0466698_176786 | 3300042610 | Bacteria | 1778 |
| 86 | Ga0466705_508012 | 3300042612 | Bacteria | 3347 |
| 87 | Ga0466718_147171 | 3300042617 | Bacteria | 1771 |
| 88 | Ga0466723_293823 | 3300042618 | Bacteria | 10602 |
| 89 | Ga0466728_254581 | 3300042620 | Unclassified | 2394 |
| 90 | Ga0456237_0006060 | 3300041968 | Bacteria | 1904 |
| 91 | Ga0466692_096783 | 3300042591 | Bacteria | 19299 |
| 92 | Ga0466691_043739 | 3300042593 | Bacteria | 24323 |
| 93 | Ga0466696_164791 | 3300042596 | Bacteria | 2286 |
| 94 | Ga0466703_051244 | 3300042636 | Bacteria | 11307 |
| 95 | Ga0466703_305461 | 3300042636 | Bacteria | 4555 |
| 96 | Ga0466704_119498 | 3300042643 | Bacteria | 6175 |
| 97 | Ga0466704_295827 | 3300042643 | Unclassified | 5131 |
| 98 | Ga0466709_018963 | 3300042648 | Bacteria | 10441 |
| 99 | Ga0466708_145218 | 3300042652 | Bacteria | 21009 |
| 100 | Ga0466708_277030 | 3300042652 | Bacteria | 5021 |
| 101 | Ga0466727_204874 | 3300042655 | Bacteria | 2210 |
| 102 | Ga0123356_10055329 | 3300010049 | Bacteria | 3696 |
| 103 | Ga0466701_067360 | 3300042598 | Bacteria | 1791 |
| 104 | Ga0466714_095312 | 3300042603 | Bacteria | 1839 |
| 105 | Ga0466719_336365 | 3300042606 | Bacteria | 1758 |
| 106 | Ga0466720_084737 | 3300042607 | Bacteria | 18029 |
| 107 | Ga0466722_157764 | 3300042609 | Bacteria | 7540 |
| 108 | Ga0466722_182467 | 3300042609 | Bacteria | 5498 |
| 109 | Ga0466718_129500 | 3300042617 | Bacteria | 1892 |
| 110 | Ga0466723_357375 | 3300042618 | Bacteria | 6207 |
| 111 | Ga0466726_097959 | 3300042619 | Bacteria | 16779 |
| 112 | Ga0466728_271121 | 3300042620 | Bacteria | 1895 |
| 113 | Ga0466732_121898 | 3300042656 | Bacteria | 6061 |
| 114 | Ga0466733_111851 | 3300042659 | Bacteria | 82439 |
| 115 | JGI24698J34947_10012555 | 3300002449 | Bacteria | 4642 |
| 116 | Ga0264413_119780 | 3300024493 | Bacteria | 4183 |
| 117 | Ga0466691_111146 | 3300042593 | Unclassified | 9805 |
| 118 | Ga0466694_160356 | 3300042594 | Bacteria | 2514 |
| 119 | Ga0466694_184274 | 3300042594 | Bacteria | 1714 |
| 120 | Ga0466696_060743 | 3300042596 | Unclassified | 2220 |
| 121 | Ga0466704_304046 | 3300042643 | Unclassified | 6533 |
| 122 | Ga0466708_182406 | 3300042652 | Unclassified | 1512 |
| 123 | Ga0466727_019210 | 3300042655 | Bacteria | 1707 |
| 124 | Ga0466719_173922 | 3300042606 | Bacteria | 34358 |
| 125 | Ga0466720_081487 | 3300042607 | Bacteria | 31706 |
| 126 | Ga0466720_096828 | 3300042607 | Bacteria | 3236 |
| 127 | Ga0466711_032414 | 3300042615 | Bacteria | 20943 |
| 128 | Ga0466723_166945 | 3300042618 | Unclassified | 1688 |
| 129 | Ga0466723_187469 | 3300042618 | Bacteria | 21499 |
| 130 | Ga0466726_076331 | 3300042619 | Bacteria | 1059 |
| 131 | Ga0466726_196858 | 3300042619 | Bacteria | 2327 |
| 132 | Ga0466705_225787 | 3300042612 | Bacteria | 6997 |
| 133 | Ga0466732_118680 | 3300042656 | Bacteria | 9111 |
| 134 | Ga0466733_210161 | 3300042659 | Bacteria | 1705 |
| 135 | JGI24698J34947_10033245 | 3300002449 | Bacteria | 2706 |
| 136 | JGI24695J34938_10025159 | 3300002450 | Bacteria | 2850 |
| 137 | JGI24695J34938_10036787 | 3300002450 | Bacteria | 2229 |
| 138 | Ga0074263_104761 | 3300005485 | Bacteria | 8480 |
| 139 | Ga0466691_127732 | 3300042593 | Bacteria | 11614 |
| 140 | Ga0466694_105531 | 3300042594 | Bacteria | 1669 |
| 141 | Ga0466694_244312 | 3300042594 | Bacteria | 37974 |
| 142 | Ga0466735_012469 | 3300042624 | Bacteria | 1706 |
| 143 | Ga0466707_109718 | 3300042601 | Bacteria | 3954 |
| 144 | Ga0466722_051815 | 3300042609 | Bacteria | 15391 |
| 145 | Ga0466722_266365 | 3300042609 | Bacteria | 11236 |
| 146 | Ga0466711_126039 | 3300042615 | Bacteria | 5250 |
| 147 | Ga0466718_054451 | 3300042617 | Bacteria | 4511 |
| 148 | Ga0466718_123395 | 3300042617 | Bacteria | 3431 |
| 149 | Ga0466723_174306 | 3300042618 | Bacteria | 10443 |
| 150 | Ga0466728_034310 | 3300042620 | Bacteria | 10596 |
| 151 | Ga0466728_418472 | 3300042620 | Bacteria | 9456 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 172 | 342 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.