Protein Family IF06917
Metagenome
Isolate
226
Members
110
Samples
163
Scaffolds
355.38
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_262071|Ga0466722_262071_17843_19045
- Length
- 400 aa
- Sequence
- MYFVHAYYHCPGVVDAIPAGFVMFEFSCVWLVPIVVTKPAILCYTLAMKMSRKTFGVLSNGKKAHLYVLKAGDITFCLTNLGAAWTSLLVPSKNGRRDDVLLGFSNCDGYLHNGPYLGVTVGRFANRIGGAHFALNGTRYNLDRNDGNNTLHGGFRGFDKQLWKADAYEENEGVFVRFELDSPGGDSGFPGRLKAVVSYGLTRSNEIIASYEASADAPTPVNFTNHAYFNLAGEGRGSILSHEVSLGSSSYVEIDSEYIPTGRLIPVRGTPFDFRTRKPIKQDMRQEFGGSGGPDAPEGYDHCFSIDGDHGKLRPCAEVYEPDSGRTIKVFTTQPGVQFYTGNMLTGIPGKTGSVYSRHTGFCLETGHFPDSPNKSNFPSCIFGPGNDYHEKTVFAFGTE
Sample Types
Isolate
27.9%
Metagenome
72.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
46.7%
Termitidae
15.9%
Kalotermitidae
13.1%
Unclassified
11.2%
Culicidae
2.8%
Rhinotermitidae
2.8%
Termopsidae
2.8%
Blattidae
0.9%
Hodotermitidae
0.9%
Passalidae
0.9%
Berytidae
0.9%
Siricidae
0.9%
Taxonomy
Archaea
0
Bacteria
214
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 2 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 3 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 8 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 9 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 10 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 11 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 12 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 17 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 18 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 19 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 20 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 21 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 22 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 23 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 24 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 30 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 31 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 32 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 33 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 34 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 44 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 45 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 46 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 47 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 48 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 49 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 50 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 57 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 58 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 59 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 60 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 61 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 62 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 63 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 64 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 65 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 66 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 67 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 68 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 69 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 70 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 71 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 72 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 73 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 75 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 76 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 77 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 78 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 79 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 80 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 81 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 82 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 83 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 84 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 85 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 86 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 87 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 88 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 89 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 90 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 91 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 92 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 93 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 94 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 95 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 96 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 97 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 98 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 99 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 100 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 101 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 102 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 103 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 104 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 105 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 106 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 107 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 108 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 109 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 110 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10102833 | 3300010167 | Bacteria | 4605 |
| 2 | Ga0123353_10255696 | 3300010167 | Unclassified | 2709 |
| 3 | Ga0123353_10260592 | 3300010167 | Bacteria | 2678 |
| 4 | Ga0123353_10344492 | 3300010167 | Bacteria | 2249 |
| 5 | Ga0160471_100980 | 3300012812 | Bacteria | 6329 |
| 6 | Ga0466711_209219 | 3300042615 | Bacteria | 6613 |
| 7 | Ga0466715_218489 | 3300042616 | Bacteria | 2432 |
| 8 | Ga0466718_037736 | 3300042617 | Bacteria | 2080 |
| 9 | Ga0466723_199267 | 3300042618 | Bacteria | 3135 |
| 10 | Ga0466723_322739 | 3300042618 | Bacteria | 3633 |
| 11 | Ga0466728_112387 | 3300042620 | Bacteria | 9197 |
| 12 | Ga0466713_033541 | 3300042602 | Bacteria | 2265 |
| 13 | Ga0466719_061898 | 3300042606 | Bacteria | 2425 |
| 14 | Ga0466729_252662 | 3300042621 | Bacteria | 3489 |
| 15 | Ga0466702_037390 | 3300042635 | Bacteria | 11627 |
| 16 | Ga0466709_129829 | 3300042648 | Bacteria | 9338 |
| 17 | Ga0466708_193326 | 3300042652 | Bacteria | 1582 |
| 18 | Ga0466691_068316 | 3300042593 | Bacteria | 35532 |
| 19 | Ga0466696_444106 | 3300042596 | Bacteria | 10449 |
| 20 | Ga0466705_011662 | 3300042612 | Bacteria | 15068 |
| 21 | Ga0466705_050037 | 3300042612 | Bacteria | 2588 |
| 22 | Ga0466732_015511 | 3300042656 | Bacteria | 1763 |
| 23 | Ga0466715_104280 | 3300042616 | Bacteria | 1364 |
| 24 | Ga0466726_042769 | 3300042619 | Bacteria | 28047 |
| 25 | Ga0466726_274917 | 3300042619 | Bacteria | 1962 |
| 26 | IMNBL1DRAFT_c0000780 | 3300000062 | Bacteria | 25177 |
| 27 | Ga0466700_305544 | 3300042600 | Bacteria | 2626 |
| 28 | Ga0466707_093490 | 3300042601 | Bacteria | 1841 |
| 29 | Ga0466713_144772 | 3300042602 | Bacteria | 8175 |
| 30 | Ga0466716_041329 | 3300042605 | Bacteria | 2983 |
| 31 | Ga0466719_284138 | 3300042606 | Bacteria | 5227 |
| 32 | Ga0466719_510865 | 3300042606 | Bacteria | 6725 |
| 33 | Ga0466720_183960 | 3300042607 | Unclassified | 3719 |
| 34 | Ga0466722_104141 | 3300042609 | Bacteria | 3809 |
| 35 | Ga0466722_181203 | 3300042609 | Bacteria | 46889 |
| 36 | Ga0466735_155443 | 3300042624 | Bacteria | 30203 |
| 37 | Ga0466704_156833 | 3300042643 | Bacteria | 2306 |
| 38 | Ga0466704_156946 | 3300042643 | Bacteria | 3001 |
| 39 | Ga0466708_398056 | 3300042652 | Bacteria | 5362 |
| 40 | Ga0466727_286870 | 3300042655 | Bacteria | 16301 |
| 41 | Ga0264413_108507 | 3300024493 | Bacteria | 3004 |
| 42 | Ga0466690_087858 | 3300042590 | Bacteria | 2082 |
| 43 | Ga0466690_194875 | 3300042590 | Unclassified | 1650 |
| 44 | Ga0466690_265407 | 3300042590 | Bacteria | 9289 |
| 45 | Ga0466692_001354 | 3300042591 | Bacteria | 5615 |
| 46 | Ga0466694_010477 | 3300042594 | Bacteria | 16833 |
| 47 | Ga0466696_219154 | 3300042596 | Bacteria | 9627 |
| 48 | Ga0466699_015014 | 3300042597 | Bacteria | 13008 |
| 49 | Ga0466699_307388 | 3300042597 | Unclassified | 1986 |
| 50 | Ga0123353_10032421 | 3300010167 | Unclassified | 8113 |
| 51 | Ga0123353_10354927 | 3300010167 | Bacteria | 2207 |
| 52 | Ga0466711_255630 | 3300042615 | Bacteria | 7937 |
| 53 | Ga0466723_035242 | 3300042618 | Bacteria | 2545 |
| 54 | Ga0466706_183331 | 3300042599 | Bacteria | 69025 |
| 55 | Ga0466720_043182 | 3300042607 | Bacteria | 19980 |
| 56 | Ga0466720_043691 | 3300042607 | Bacteria | 5164 |
| 57 | Ga0466720_157834 | 3300042607 | Unclassified | 2238 |
| 58 | Ga0466703_113252 | 3300042636 | Bacteria | 2099 |
| 59 | Ga0466704_078922 | 3300042643 | Bacteria | 6742 |
| 60 | Ga0466708_339785 | 3300042652 | Bacteria | 6606 |
| 61 | Ga0466727_225117 | 3300042655 | Bacteria | 5196 |
| 62 | Ga0466727_253139 | 3300042655 | Bacteria | 9060 |
| 63 | Ga0466696_174752 | 3300042596 | Bacteria | 4303 |
| 64 | Ga0466699_120667 | 3300042597 | Bacteria | 6315 |
| 65 | Ga0466699_223788 | 3300042597 | Bacteria | 7509 |
| 66 | Ga0466699_308453 | 3300042597 | Bacteria | 2440 |
| 67 | Ga0466732_080089 | 3300042656 | Bacteria | 10952 |
| 68 | Ga0123353_10003322 | 3300010167 | Bacteria | 20296 |
| 69 | Ga0072941_1021522 | 3300005201 | Bacteria | 13567 |
| 70 | Ga0466719_223946 | 3300042606 | Bacteria | 5422 |
| 71 | Ga0466720_001706 | 3300042607 | Unclassified | 5615 |
| 72 | Ga0466720_050711 | 3300042607 | Bacteria | 42730 |
| 73 | Ga0466722_016024 | 3300042609 | Bacteria | 6843 |
| 74 | Ga0466703_071566 | 3300042636 | Bacteria | 3022 |
| 75 | Ga0466703_136395 | 3300042636 | Bacteria | 2305 |
| 76 | Ga0466704_142002 | 3300042643 | Bacteria | 3189 |
| 77 | Ga0466727_033542 | 3300042655 | Bacteria | 1590 |
| 78 | Ga0415639_013342 | 3300038395 | Bacteria | 3844 |
| 79 | Ga0466692_143613 | 3300042591 | Bacteria | 3655 |
| 80 | Ga0466693_340263 | 3300042592 | Bacteria | 1495 |
| 81 | Ga0466694_364923 | 3300042594 | Bacteria | 4530 |
| 82 | Ga0466732_224177 | 3300042656 | Bacteria | 2156 |
| 83 | Ga0123353_10413077 | 3300010167 | Bacteria | 2003 |
| 84 | Ga0123353_10672965 | 3300010167 | Bacteria | 1459 |
| 85 | Ga0466715_044539 | 3300042616 | Bacteria | 4328 |
| 86 | Ga0466723_210331 | 3300042618 | Bacteria | 2274 |
| 87 | JGI24695J34938_10008871 | 3300002450 | Bacteria | 5681 |
| 88 | Ga0068305_10508729 | 3300005083 | Bacteria | 6482 |
| 89 | Ga0072940_1095869 | 3300005200 | Bacteria | 10182 |
| 90 | Ga0466703_121691 | 3300042636 | Bacteria | 4585 |
| 91 | Ga0466703_213760 | 3300042636 | Bacteria | 8690 |
| 92 | Ga0466703_306512 | 3300042636 | Bacteria | 50589 |
| 93 | Ga0466704_103406 | 3300042643 | Bacteria | 3120 |
| 94 | Ga0466704_215777 | 3300042643 | Bacteria | 9662 |
| 95 | Ga0466727_157437 | 3300042655 | Bacteria | 2143 |
| 96 | Ga0160435_1001560 | 3300012857 | Unclassified | 5774 |
| 97 | Ga0264413_117078 | 3300024493 | Bacteria | 4176 |
| 98 | Ga0466696_302250 | 3300042596 | Bacteria | 2179 |
| 99 | Ga0466715_080521 | 3300042616 | Bacteria | 10514 |
| 100 | Ga0466723_335847 | 3300042618 | Bacteria | 9423 |
| 101 | Ga0466726_072030 | 3300042619 | Bacteria | 4146 |
| 102 | Ga0466726_073988 | 3300042619 | Bacteria | 4692 |
| 103 | Ga0466728_126343 | 3300042620 | Bacteria | 2430 |
| 104 | AustNasuHG_c1005755 | 3300000089 | Bacteria | 4427 |
| 105 | JGI24698J34947_10054940 | 3300002449 | Bacteria | 1986 |
| 106 | Ga0466716_521334 | 3300042605 | Bacteria | 2429 |
| 107 | Ga0466719_205004 | 3300042606 | Bacteria | 3859 |
| 108 | Ga0466704_049599 | 3300042643 | Bacteria | 4185 |
| 109 | Ga0466727_069119 | 3300042655 | Bacteria | 1246 |
| 110 | Ga0466690_107729 | 3300042590 | Bacteria | 2272 |
| 111 | Ga0466694_027531 | 3300042594 | Bacteria | 10377 |
| 112 | Ga0466694_231615 | 3300042594 | Bacteria | 4550 |
| 113 | Ga0466705_025816 | 3300042612 | Bacteria | 1873 |
| 114 | Ga0466705_345057 | 3300042612 | Unclassified | 3329 |
| 115 | Ga0466732_069461 | 3300042656 | Bacteria | 1180 |
| 116 | Ga0466732_137446 | 3300042656 | Unclassified | 1302 |
| 117 | Ga0466732_411412 | 3300042656 | Bacteria | 4336 |
| 118 | Ga0123353_10061115 | 3300010167 | Bacteria | 6042 |
| 119 | Ga0123353_10452287 | 3300010167 | Bacteria | 1890 |
| 120 | Ga0123353_10669899 | 3300010167 | Bacteria | 1464 |
| 121 | Ga0466718_156416 | 3300042617 | Bacteria | 8512 |
| 122 | Ga0466723_135412 | 3300042618 | Bacteria | 4023 |
| 123 | Ga0466723_265366 | 3300042618 | Bacteria | 1683 |
| 124 | Ga0466723_291981 | 3300042618 | Bacteria | 4621 |
| 125 | AustNasuHG_c1011627 | 3300000089 | Bacteria | 3048 |
| 126 | JGI24695J34938_10026593 | 3300002450 | Bacteria | 2748 |
| 127 | JGI24702J35022_10010145 | 3300002462 | Bacteria | 5275 |
| 128 | Ga0466720_062054 | 3300042607 | Bacteria | 2175 |
| 129 | Ga0466720_084636 | 3300042607 | Bacteria | 5100 |
| 130 | Ga0466720_115684 | 3300042607 | Bacteria | 2119 |
| 131 | Ga0466722_262071 | 3300042609 | Bacteria | 23442 |
| 132 | Ga0466709_349319 | 3300042648 | Bacteria | 1400 |
| 133 | Ga0160447_100066 | 3300012849 | Unclassified | 97109 |
| 134 | Ga0466692_168180 | 3300042591 | Bacteria | 13839 |
| 135 | Ga0466691_036636 | 3300042593 | Bacteria | 4073 |
| 136 | Ga0466691_126427 | 3300042593 | Bacteria | 3568 |
| 137 | Ga0466696_062480 | 3300042596 | Bacteria | 2472 |
| 138 | Ga0466696_419727 | 3300042596 | Bacteria | 8488 |
| 139 | Ga0466699_248577 | 3300042597 | Bacteria | 1660 |
| 140 | Ga0466705_242662 | 3300042612 | Bacteria | 3920 |
| 141 | Ga0123353_10057737 | 3300010167 | Bacteria | 6217 |
| 142 | Ga0123353_10588365 | 3300010167 | Bacteria | 1594 |
| 143 | Ga0466712_121768 | 3300042614 | Bacteria | 1998 |
| 144 | Ga0466711_121145 | 3300042615 | Bacteria | 20134 |
| 145 | Ga0466715_032258 | 3300042616 | Bacteria | 5631 |
| 146 | Ga0466726_123882 | 3300042619 | Bacteria | 8125 |
| 147 | JGI24702J35022_10025894 | 3300002462 | Bacteria | 3163 |
| 148 | Ga0072941_1071690 | 3300005201 | Bacteria | 2751 |
| 149 | Ga0466719_024195 | 3300042606 | Bacteria | 4717 |
| 150 | Ga0466722_005288 | 3300042609 | Bacteria | 5572 |
| 151 | Ga0466722_024179 | 3300042609 | Bacteria | 3770 |
| 152 | Ga0466722_160382 | 3300042609 | Bacteria | 30194 |
| 153 | Ga0466722_228758 | 3300042609 | Bacteria | 3388 |
| 154 | Ga0466729_296835 | 3300042621 | Bacteria | 1298 |
| 155 | Ga0466704_427505 | 3300042643 | Unclassified | 2888 |
| 156 | Ga0466709_235300 | 3300042648 | Bacteria | 3694 |
| 157 | Ga0466708_057592 | 3300042652 | Bacteria | 5062 |
| 158 | Ga0466708_210566 | 3300042652 | Bacteria | 12593 |
| 159 | Ga0466727_062817 | 3300042655 | Bacteria | 1634 |
| 160 | Ga0264413_114595 | 3300024493 | Bacteria | 7509 |
| 161 | Ga0466690_098241 | 3300042590 | Bacteria | 1788 |
| 162 | Ga0466690_271589 | 3300042590 | Bacteria | 3038 |
| 163 | Ga0466695_197689 | 3300042595 | Bacteria | 7117 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01263 | Aldose_epim | Aldose 1-epimerase | 66 | 395 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.