Protein Family IF06897
Metagenome
Isolate
235
Members
139
Samples
142
Scaffolds
154.3
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_226256|Ga0466722_226256_5278_5805
- Length
- 175 aa
- Sequence
- MALDIYTDGGCSGHPGPGGWAWVMVQTTFQGEAVLAEDSGSRPDTTNNRMELEAVISALKAFRALQARAAPAGLRQSGSSGTPPAAGPGIPRTAVVHTDSQYVQKGITGWIIAWKRNSWRTSDKKPVKNQDLWKELDDLAGSLDLRWEWVRGHAGNPWNERCDRMTGEAIRELKG
Sample Types
Isolate
39.6%
Metagenome
60.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
58.8%
Termitidae
15.4%
Kalotermitidae
9.6%
Unclassified
8.1%
Rhinotermitidae
2.2%
Berytidae
1.5%
Termopsidae
1.5%
Formicidae
0.7%
Culicidae
0.7%
Hodotermitidae
0.7%
Alydidae
0.7%
Taxonomy
Archaea
2
Bacteria
225
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 2 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 3 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 4 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 5 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 6 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 7 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 8 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 9 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 10 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 11 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 12 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 13 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 16 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 17 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 18 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 19 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 20 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 21 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 22 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 23 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 24 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 25 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 30 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 31 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 37 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 38 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 39 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 40 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 41 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 42 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 43 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 44 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 45 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 46 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 47 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 52 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 53 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 54 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 55 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 56 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 57 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 58 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 59 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 60 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 61 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 62 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 63 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 64 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 65 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 66 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 67 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 68 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 69 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 70 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 71 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 72 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 73 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 74 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 75 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 76 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 77 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 78 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 79 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 80 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 81 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 82 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 83 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 84 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 85 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 86 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 87 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 88 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 89 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 90 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 91 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 92 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 93 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 94 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 95 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 96 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 97 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 98 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 99 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 100 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 101 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 102 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 103 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 104 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 105 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 106 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 107 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 108 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 109 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 110 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 111 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 112 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 113 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 114 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 115 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 116 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 117 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 118 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 119 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 120 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 121 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 122 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 123 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 124 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 125 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 126 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 127 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 128 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 129 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 130 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 131 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 132 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 133 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 134 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 135 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 136 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 137 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 138 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 139 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_121031 | 3300042612 | Unclassified | 1505 |
| 2 | Ga0466705_291576 | 3300042612 | Bacteria | 5208 |
| 3 | Ga0123357_10114983 | 3300009784 | Bacteria | 3413 |
| 4 | Ga0123357_10229904 | 3300009784 | Bacteria | 2035 |
| 5 | Ga0123356_10992066 | 3300010049 | Bacteria | 1010 |
| 6 | Ga0123354_10073541 | 3300010882 | Bacteria | 4907 |
| 7 | JGI24698J34947_10070831 | 3300002449 | Bacteria | 1676 |
| 8 | JGI24695J34938_10000582 | 3300002450 | Bacteria | 35275 |
| 9 | JGI24695J34938_10001125 | 3300002450 | Bacteria | 24008 |
| 10 | Ga0072941_1006962 | 3300005201 | Bacteria | 4194 |
| 11 | Ga0466712_000594 | 3300042614 | Bacteria | 29291 |
| 12 | Ga0466722_069303 | 3300042609 | Bacteria | 11588 |
| 13 | Ga0466730_012272 | 3300042625 | Bacteria | 5807 |
| 14 | Ga0466703_063115 | 3300042636 | Bacteria | 5692 |
| 15 | Ga0466704_181822 | 3300042643 | Bacteria | 3242 |
| 16 | Ga0466704_184200 | 3300042643 | Bacteria | 6085 |
| 17 | Ga0466704_473349 | 3300042643 | Bacteria | 1281 |
| 18 | Ga0466727_067958 | 3300042655 | Bacteria | 45910 |
| 19 | Ga0466692_185587 | 3300042591 | Bacteria | 2297 |
| 20 | Ga0466694_071281 | 3300042594 | Bacteria | 1935 |
| 21 | Ga0466699_087326 | 3300042597 | Archaea | 7562 |
| 22 | Ga0123357_10080713 | 3300009784 | Bacteria | 4278 |
| 23 | Ga0123356_10015329 | 3300010049 | Bacteria | 7350 |
| 24 | Ga0123356_10087155 | 3300010049 | Bacteria | 2965 |
| 25 | AustNasuHG_c1019122 | 3300000089 | Bacteria | 2252 |
| 26 | JGI24698J34947_10068551 | 3300002449 | Bacteria | 1715 |
| 27 | JGI24695J34938_10000099 | 3300002450 | Bacteria | 75735 |
| 28 | JGI24695J34938_10021327 | 3300002450 | Archaea | 3170 |
| 29 | Ga0466706_220755 | 3300042599 | Bacteria | 1052 |
| 30 | Ga0466717_103271 | 3300042604 | Bacteria | 1600 |
| 31 | Ga0466722_002896 | 3300042609 | Bacteria | 2102 |
| 32 | Ga0466704_254351 | 3300042643 | Bacteria | 55313 |
| 33 | Ga0466694_051448 | 3300042594 | Bacteria | 1075 |
| 34 | Ga0466695_290770 | 3300042595 | Bacteria | 97007 |
| 35 | JGI24695J34938_10000071 | 3300002450 | Bacteria | 85834 |
| 36 | JGI24695J34938_10000884 | 3300002450 | Bacteria | 27680 |
| 37 | JGI24695J34938_10014076 | 3300002450 | Unclassified | 4166 |
| 38 | Ga0072940_1054920 | 3300005200 | Bacteria | 4145 |
| 39 | Ga0072941_1014834 | 3300005201 | Unclassified | 10537 |
| 40 | Ga0072941_1042373 | 3300005201 | Bacteria | 2537 |
| 41 | Ga0466712_220415 | 3300042614 | Bacteria | 8826 |
| 42 | Ga0466718_045342 | 3300042617 | Bacteria | 1107 |
| 43 | Ga0466723_051820 | 3300042618 | Bacteria | 14825 |
| 44 | Ga0466720_055911 | 3300042607 | Bacteria | 20469 |
| 45 | Ga0466731_270503 | 3300042622 | Bacteria | 27160 |
| 46 | Ga0466735_061209 | 3300042624 | Bacteria | 23420 |
| 47 | Ga0466703_113070 | 3300042636 | Bacteria | 3213 |
| 48 | Ga0466709_120242 | 3300042648 | Bacteria | 6665 |
| 49 | Ga0466724_51767 | 3300042649 | Bacteria | 2373 |
| 50 | Ga0160459_100566 | 3300012831 | Unclassified | 13623 |
| 51 | Ga0466690_014992 | 3300042590 | Bacteria | 25664 |
| 52 | Ga0466693_331229 | 3300042592 | Bacteria | 1741 |
| 53 | Ga0466695_141187 | 3300042595 | Bacteria | 3005 |
| 54 | Ga0466699_028748 | 3300042597 | Bacteria | 5251 |
| 55 | Ga0123356_10018415 | 3300010049 | Bacteria | 6631 |
| 56 | Ga0123356_10467735 | 3300010049 | Bacteria | 1412 |
| 57 | JGI24698J34947_10000092 | 3300002449 | Bacteria | 30066 |
| 58 | JGI24698J34947_10080658 | 3300002449 | Bacteria | 1528 |
| 59 | JGI24695J34938_10001540 | 3300002450 | Bacteria | 19420 |
| 60 | Ga0072941_1006963 | 3300005201 | Unclassified | 8102 |
| 61 | Ga0072941_1297759 | 3300005201 | Bacteria | 1689 |
| 62 | Ga0466715_259045 | 3300042616 | Bacteria | 11825 |
| 63 | Ga0466707_095822 | 3300042601 | Bacteria | 1077 |
| 64 | Ga0466716_143274 | 3300042605 | Bacteria | 1128 |
| 65 | Ga0466716_419312 | 3300042605 | Bacteria | 1070 |
| 66 | Ga0466719_371529 | 3300042606 | Bacteria | 3079 |
| 67 | Ga0466703_183254 | 3300042636 | Bacteria | 8620 |
| 68 | Ga0466704_028879 | 3300042643 | Bacteria | 6128 |
| 69 | Ga0466709_026381 | 3300042648 | Bacteria | 6206 |
| 70 | Ga0466708_216552 | 3300042652 | Bacteria | 4087 |
| 71 | Ga0466699_367705 | 3300042597 | Bacteria | 2591 |
| 72 | Ga0123356_10132616 | 3300010049 | Bacteria | 2443 |
| 73 | Ga0123353_10244867 | 3300010167 | Bacteria | 2782 |
| 74 | Ga0123353_10512877 | 3300010167 | Bacteria | 1742 |
| 75 | JGI24698J34947_10004885 | 3300002449 | Bacteria | 7345 |
| 76 | JGI24698J34947_10006289 | 3300002449 | Bacteria | 6525 |
| 77 | JGI24698J34947_10119935 | 3300002449 | Bacteria | 1143 |
| 78 | JGI24695J34938_10005922 | 3300002450 | Bacteria | 7490 |
| 79 | JGI24695J34938_10022600 | 3300002450 | Bacteria | 3050 |
| 80 | Ga0103264_1008724 | 3300007188 | Bacteria | 8704 |
| 81 | Ga0466712_007685 | 3300042614 | Bacteria | 25961 |
| 82 | Ga0466712_050747 | 3300042614 | Bacteria | 26175 |
| 83 | Ga0466715_457381 | 3300042616 | Bacteria | 1613 |
| 84 | Ga0466727_100871 | 3300042655 | Bacteria | 1200 |
| 85 | Ga0466691_116458 | 3300042593 | Bacteria | 33461 |
| 86 | Ga0466694_080768 | 3300042594 | Bacteria | 27428 |
| 87 | Ga0466694_126266 | 3300042594 | Bacteria | 1302 |
| 88 | Ga0466699_301931 | 3300042597 | Bacteria | 7433 |
| 89 | Ga0466699_392025 | 3300042597 | Bacteria | 2318 |
| 90 | Ga0466705_217998 | 3300042612 | Bacteria | 4301 |
| 91 | Ga0123356_10260670 | 3300010049 | Bacteria | 1817 |
| 92 | Ga0123356_10842511 | 3300010049 | Bacteria | 1088 |
| 93 | Ga0123353_10000093 | 3300010167 | Bacteria | 101734 |
| 94 | Ga0123353_10160875 | 3300010167 | Bacteria | 3575 |
| 95 | AustNasuHG_c1016711 | 3300000089 | Bacteria | 2449 |
| 96 | JGI24698J34947_10010433 | 3300002449 | Bacteria | 5094 |
| 97 | JGI24698J34947_10029553 | 3300002449 | Bacteria | 2895 |
| 98 | JGI24695J34938_10001611 | 3300002450 | Bacteria | 18969 |
| 99 | Ga0072941_1002303 | 3300005201 | Bacteria | 12126 |
| 100 | Ga0072941_1004505 | 3300005201 | Bacteria | 18383 |
| 101 | Ga0466705_472159 | 3300042612 | Bacteria | 1094 |
| 102 | Ga0466715_593722 | 3300042616 | Bacteria | 15170 |
| 103 | Ga0466718_028747 | 3300042617 | Bacteria | 3636 |
| 104 | Ga0466718_030577 | 3300042617 | Bacteria | 14715 |
| 105 | Ga0466729_168458 | 3300042621 | Bacteria | 12810 |
| 106 | Ga0466707_285995 | 3300042601 | Bacteria | 1432 |
| 107 | Ga0466716_066332 | 3300042605 | Bacteria | 3864 |
| 108 | Ga0466722_226256 | 3300042609 | Bacteria | 6297 |
| 109 | Ga0466731_033596 | 3300042622 | Bacteria | 1545 |
| 110 | Ga0466704_236214 | 3300042643 | Unclassified | 3138 |
| 111 | Ga0160452_100061 | 3300012834 | Bacteria | 144414 |
| 112 | Ga0264413_111745 | 3300024493 | Bacteria | 49890 |
| 113 | Ga0466696_283769 | 3300042596 | Bacteria | 7360 |
| 114 | Ga0466699_028247 | 3300042597 | Bacteria | 4181 |
| 115 | Ga0466699_031094 | 3300042597 | Bacteria | 6354 |
| 116 | Ga0123355_10488279 | 3300009826 | Bacteria | 1527 |
| 117 | JGI24698J34947_10026251 | 3300002449 | Bacteria | 3096 |
| 118 | JGI24695J34938_10001419 | 3300002450 | Bacteria | 20419 |
| 119 | Ga0072941_1042353 | 3300005201 | Bacteria | 1758 |
| 120 | Ga0123357_10000489 | 3300009784 | Bacteria | 38470 |
| 121 | Ga0466712_146087 | 3300042614 | Bacteria | 6558 |
| 122 | Ga0466712_293154 | 3300042614 | Bacteria | 18439 |
| 123 | Ga0466712_306078 | 3300042614 | Bacteria | 1471 |
| 124 | Ga0466707_303860 | 3300042601 | Bacteria | 5303 |
| 125 | Ga0466719_046847 | 3300042606 | Bacteria | 3651 |
| 126 | Ga0466719_559531 | 3300042606 | Bacteria | 4156 |
| 127 | Ga0466694_002023 | 3300042594 | Bacteria | 1368 |
| 128 | Ga0466699_194618 | 3300042597 | Bacteria | 2396 |
| 129 | Ga0123356_10004368 | 3300010049 | Bacteria | 14620 |
| 130 | Ga0123353_12451248 | 3300010167 | Bacteria | 622 |
| 131 | JGI24698J34947_10034098 | 3300002449 | Bacteria | 2666 |
| 132 | Ga0072941_1019156 | 3300005201 | Unclassified | 10224 |
| 133 | Ga0466712_264942 | 3300042614 | Bacteria | 9193 |
| 134 | Ga0466711_516899 | 3300042615 | Bacteria | 1488 |
| 135 | Ga0466707_015648 | 3300042601 | Bacteria | 22203 |
| 136 | Ga0466707_382023 | 3300042601 | Unclassified | 11381 |
| 137 | Ga0466719_030078 | 3300042606 | Bacteria | 26685 |
| 138 | Ga0466735_170571 | 3300042624 | Bacteria | 1636 |
| 139 | Ga0466709_051433 | 3300042648 | Bacteria | 24663 |
| 140 | Ga0415639_074624 | 3300038395 | Bacteria | 4108 |
| 141 | Ga0466690_133650 | 3300042590 | Bacteria | 3755 |
| 142 | Ga0466699_325163 | 3300042597 | Bacteria | 10238 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00075 | RNase_H | RNase H | 92 | 170 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.