Protein Family IF06896
Metagenome
115
Members
46
Samples
115
Scaffolds
117.11
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_226151|Ga0466722_226151_1719_2108
- Length
- 129 aa
- Sequence
- MYIEVLKSKIHRVTVTEANLNYIGSITIDENLMDAARLTEYEKVYVLNNNNGERFETYVIRGVRGSGVICLNGAAARRVLPGDVIIILSYAQVDAEEAKTFRPTVVFPDTATNQLTQQSLAAASGGQFP
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.4%
Kalotermitidae
31.8%
Termopsidae
9.1%
Unclassified
6.8%
Rhinotermitidae
4.5%
Tenebrionidae
4.5%
Passalidae
4.5%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_274917 | 3300042611 | Bacteria | 203310 |
| 2 | Ga0466700_396225 | 3300042600 | Bacteria | 1051 |
| 3 | Ga0466716_099989 | 3300042605 | Bacteria | 2486 |
| 4 | Ga0466716_201116 | 3300042605 | Bacteria | 2756 |
| 5 | Ga0466719_101062 | 3300042606 | Bacteria | 11428 |
| 6 | Ga0123356_12698835 | 3300010049 | Bacteria | 622 |
| 7 | Ga0160441_100011 | 3300012825 | Bacteria | 461375 |
| 8 | Ga0466735_073966 | 3300042624 | Bacteria | 12662 |
| 9 | Ga0466727_274506 | 3300042655 | Bacteria | 3915 |
| 10 | 2227278034 | 2225789004 | Bacteria | 6831 |
| 11 | IMNBL1DRAFT_c0152380 | 3300000062 | Bacteria | 593 |
| 12 | Ga0530661_000065 | 3300056564 | Bacteria | 102105 |
| 13 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 14 | Ga0466707_272049 | 3300042601 | Bacteria | 5307 |
| 15 | Ga0466713_001038 | 3300042602 | Bacteria | 10397 |
| 16 | Ga0466719_056510 | 3300042606 | Bacteria | 2531 |
| 17 | Ga0466722_232470 | 3300042609 | Bacteria | 73289 |
| 18 | Ga0466690_174107 | 3300042590 | Bacteria | 4795 |
| 19 | Ga0466692_089051 | 3300042591 | Bacteria | 8472 |
| 20 | Ga0466703_221509 | 3300042636 | Bacteria | 34236 |
| 21 | Ga0466711_237585 | 3300042615 | Bacteria | 14562 |
| 22 | Ga0466726_325235 | 3300042619 | Bacteria | 10823 |
| 23 | 2227403592 | 2225789004 | Bacteria | 1069 |
| 24 | Ga0466733_203606 | 3300042659 | Bacteria | 45615 |
| 25 | Ga0466706_004870 | 3300042599 | Bacteria | 1886 |
| 26 | Ga0466707_219838 | 3300042601 | Bacteria | 2212 |
| 27 | Ga0466714_126568 | 3300042603 | Bacteria | 1099 |
| 28 | Ga0466716_300817 | 3300042605 | Bacteria | 4070 |
| 29 | Ga0123353_11012554 | 3300010167 | Bacteria | 1115 |
| 30 | Ga0466691_076358 | 3300042593 | Bacteria | 13671 |
| 31 | Ga0466691_092528 | 3300042593 | Bacteria | 24266 |
| 32 | Ga0466694_219505 | 3300042594 | Bacteria | 2133 |
| 33 | Ga0466696_099554 | 3300042596 | Bacteria | 1573 |
| 34 | Ga0466704_609445 | 3300042643 | Bacteria | 11734 |
| 35 | Ga0466727_042006 | 3300042655 | Bacteria | 21469 |
| 36 | Ga0466727_329353 | 3300042655 | Bacteria | 6969 |
| 37 | Ga0466727_332340 | 3300042655 | Bacteria | 1150 |
| 38 | Ga0466715_641988 | 3300042616 | Bacteria | 13526 |
| 39 | Ga0466723_007696 | 3300042618 | Bacteria | 37981 |
| 40 | Ga0466726_145580 | 3300042619 | Bacteria | 1604 |
| 41 | JGI24705J35276_12238474 | 3300002504 | Bacteria | 23401 |
| 42 | Ga0068305_10985997 | 3300005083 | Bacteria | 1287 |
| 43 | Ga0466713_022445 | 3300042602 | Bacteria | 20407 |
| 44 | Ga0466713_025896 | 3300042602 | Bacteria | 7016 |
| 45 | Ga0466713_131527 | 3300042602 | Bacteria | 55397 |
| 46 | Ga0466716_203370 | 3300042605 | Bacteria | 6139 |
| 47 | Ga0466722_226151 | 3300042609 | Bacteria | 6031 |
| 48 | Ga0466690_055087 | 3300042590 | Bacteria | 12574 |
| 49 | Ga0466690_356823 | 3300042590 | Bacteria | 32247 |
| 50 | Ga0466735_225047 | 3300042624 | Bacteria | 1663 |
| 51 | Ga0466703_368321 | 3300042636 | Bacteria | 4075 |
| 52 | Ga0466708_254922 | 3300042652 | Bacteria | 84207 |
| 53 | Ga0466725_156127 | 3300042654 | Bacteria | 8347 |
| 54 | Ga0466727_155062 | 3300042655 | Bacteria | 2043 |
| 55 | Ga0466715_120209 | 3300042616 | Bacteria | 19742 |
| 56 | Ga0466715_635823 | 3300042616 | Bacteria | 16106 |
| 57 | Ga0466726_120860 | 3300042619 | Bacteria | 1773 |
| 58 | JGI24696J40584_12958679 | 3300002834 | Bacteria | 4322 |
| 59 | Ga0068302_10271071 | 3300005071 | Unclassified | 1552 |
| 60 | Ga0068305_10014392 | 3300005083 | Bacteria | 12143 |
| 61 | Ga0068305_10146876 | 3300005083 | Bacteria | 12973 |
| 62 | Ga0072940_1269095 | 3300005200 | Bacteria | 852 |
| 63 | Ga0466705_027874 | 3300042612 | Bacteria | 2225 |
| 64 | Ga0466705_068603 | 3300042612 | Bacteria | 9276 |
| 65 | Ga0466733_115397 | 3300042659 | Bacteria | 3270 |
| 66 | Ga0466714_065971 | 3300042603 | Bacteria | 1226 |
| 67 | Ga0466716_021809 | 3300042605 | Bacteria | 14137 |
| 68 | Ga0123353_13064620 | 3300010167 | Bacteria | 539 |
| 69 | Ga0123354_10190040 | 3300010882 | Bacteria | 2303 |
| 70 | Ga0466657_090039 | 3300042582 | Bacteria | 3346 |
| 71 | Ga0466696_099459 | 3300042596 | Unclassified | 4327 |
| 72 | Ga0466703_228165 | 3300042636 | Bacteria | 7943 |
| 73 | Ga0466709_188561 | 3300042648 | Bacteria | 17954 |
| 74 | Ga0466708_247211 | 3300042652 | Bacteria | 7042 |
| 75 | Ga0466728_016383 | 3300042620 | Bacteria | 48703 |
| 76 | 2227480404 | 2225789004 | Bacteria | 853 |
| 77 | Ga0466706_040036 | 3300042599 | Bacteria | 4233 |
| 78 | Ga0466714_103338 | 3300042603 | Bacteria | 4695 |
| 79 | Ga0466716_458123 | 3300042605 | Bacteria | 3208 |
| 80 | Ga0466719_236854 | 3300042606 | Bacteria | 8981 |
| 81 | Ga0466696_322939 | 3300042596 | Bacteria | 1148 |
| 82 | Ga0466704_040810 | 3300042643 | Bacteria | 25809 |
| 83 | Ga0466708_384964 | 3300042652 | Bacteria | 11092 |
| 84 | Ga0466727_035235 | 3300042655 | Bacteria | 14696 |
| 85 | Ga0466711_129276 | 3300042615 | Bacteria | 8151 |
| 86 | Ga0466715_257264 | 3300042616 | Bacteria | 11253 |
| 87 | Ga0466728_156808 | 3300042620 | Bacteria | 8145 |
| 88 | JGI24699J35502_11068455 | 3300002509 | Bacteria | 1816 |
| 89 | Ga0068305_10044024 | 3300005083 | Bacteria | 5850 |
| 90 | Ga0466713_020955 | 3300042602 | Bacteria | 68417 |
| 91 | Ga0466722_093024 | 3300042609 | Bacteria | 4299 |
| 92 | Ga0466695_107650 | 3300042595 | Bacteria | 1145 |
| 93 | Ga0466696_013648 | 3300042596 | Bacteria | 29440 |
| 94 | Ga0466704_209026 | 3300042643 | Bacteria | 44176 |
| 95 | Ga0466724_09361 | 3300042649 | Bacteria | 5375 |
| 96 | Ga0466723_037971 | 3300042618 | Bacteria | 22013 |
| 97 | Ga0466726_448924 | 3300042619 | Bacteria | 3820 |
| 98 | 2227466078 | 2225789004 | Bacteria | 968 |
| 99 | IMNBL1DRAFT_c0000728 | 3300000062 | Bacteria | 26085 |
| 100 | Ga0068305_10002986 | 3300005083 | Bacteria | 1648 |
| 101 | Ga0466733_154633 | 3300042659 | Bacteria | 1167 |
| 102 | Ga0466716_010882 | 3300042605 | Bacteria | 10392 |
| 103 | Ga0466719_216763 | 3300042606 | Bacteria | 5948 |
| 104 | Ga0466719_445466 | 3300042606 | Bacteria | 9216 |
| 105 | Ga0466690_034251 | 3300042590 | Bacteria | 1969 |
| 106 | Ga0466696_107787 | 3300042596 | Bacteria | 4137 |
| 107 | Ga0466703_304695 | 3300042636 | Bacteria | 4151 |
| 108 | Ga0466704_339221 | 3300042643 | Bacteria | 6084 |
| 109 | Ga0466709_159970 | 3300042648 | Bacteria | 21375 |
| 110 | Ga0466725_084562 | 3300042654 | Bacteria | 24813 |
| 111 | Ga0466727_012578 | 3300042655 | Bacteria | 8903 |
| 112 | Ga0466715_432310 | 3300042616 | Bacteria | 6956 |
| 113 | Ga0466723_257060 | 3300042618 | Bacteria | 14108 |
| 114 | Ga0068302_10087066 | 3300005071 | Bacteria | 2741 |
| 115 | Ga0072941_1012132 | 3300005201 | Bacteria | 7023 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02261 | Asp_decarbox | Aspartate decarboxylase | 1 | 112 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.