Protein Family IF06855
Metagenome
Isolate
175
Members
54
Samples
163
Scaffolds
415.93
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_175521|Ga0466722_175521_52_1377
- Length
- 441 aa
- Sequence
- MGAAEPARFVEAANPPFMEHKEQNMGFPVNSYTKSAEAFKRALKVIPSGIYGHQGPAEGCFVPVSAFPFFSERAKGAYFWDIDGNRFIDYMCAYGPNVLGYNDGEIDEAAAKQRVRGDCITAPSFAMIDFAELLVDTVACADWAFFAKNGGDVTTLAVITARAHTRRKKIVFFKGYYHGVAPWTQKIDYPGILEEDVANNIYVPWNDYDKLAGVFAENKGEIAAVISQPYLHGNFADNVLPAEGFWPKVRKLCDDSGAVLIIDDVRAGFRLDLAGSDHYFGFKADLICFCKALANGYNVSALCGQEFLRNTVSALTYTGSYWLSAVPFAAGVACINKMKRIDLPRLLRERGTKLRDGLVAVAKKHGHDLRVTGEPALFYLRLADDDHGGAPSLMLHQRWIAEMVKRGVYVTSHHNHFINAALSEEDIAFTVAVADEAFAAL
Sample Types
Isolate
6.9%
Metagenome
93.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.2%
Unclassified
28.3%
Kalotermitidae
26.4%
Termopsidae
5.7%
Culicidae
3.8%
Rhinotermitidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
156
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 12 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 13 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 24 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 32 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 39 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 40 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 51 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 52 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_194068 | 3300042612 | Bacteria | 1891 |
| 2 | Ga0466690_078766 | 3300042590 | Unclassified | 2398 |
| 3 | Ga0466691_076227 | 3300042593 | Bacteria | 10240 |
| 4 | Ga0466694_398806 | 3300042594 | Bacteria | 1095 |
| 5 | Ga0466696_135038 | 3300042596 | Bacteria | 1776 |
| 6 | Ga0466696_252968 | 3300042596 | Bacteria | 15340 |
| 7 | Ga0123353_10000932 | 3300010167 | Bacteria | 35762 |
| 8 | Ga0123353_10190185 | 3300010167 | Bacteria | 3241 |
| 9 | Ga0466715_463274 | 3300042616 | Bacteria | 11063 |
| 10 | Ga0466723_334202 | 3300042618 | Unclassified | 13620 |
| 11 | Ga0466704_130747 | 3300042643 | Bacteria | 1939 |
| 12 | Ga0466709_275749 | 3300042648 | Bacteria | 2675 |
| 13 | Ga0466708_345248 | 3300042652 | Bacteria | 9453 |
| 14 | Ga0160435_1003081 | 3300012857 | Bacteria | 3977 |
| 15 | Ga0415639_009925 | 3300038395 | Bacteria | 63362 |
| 16 | Ga0415639_038077 | 3300038395 | Bacteria | 4307 |
| 17 | Ga0466690_280054 | 3300042590 | Unclassified | 3683 |
| 18 | Ga0466690_399999 | 3300042590 | Bacteria | 6386 |
| 19 | Ga0466692_142303 | 3300042591 | Bacteria | 11124 |
| 20 | Ga0466691_116197 | 3300042593 | Bacteria | 2925 |
| 21 | Ga0466696_027259 | 3300042596 | Bacteria | 4642 |
| 22 | Ga0123355_10000500 | 3300009826 | Bacteria | 52249 |
| 23 | Ga0123356_10000145 | 3300010049 | Bacteria | 79704 |
| 24 | Ga0466711_101269 | 3300042615 | Bacteria | 28356 |
| 25 | Ga0466711_392673 | 3300042615 | Bacteria | 22721 |
| 26 | Ga0466715_407765 | 3300042616 | Bacteria | 3078 |
| 27 | Ga0466726_163522 | 3300042619 | Bacteria | 7138 |
| 28 | Ga0466703_071731 | 3300042636 | Bacteria | 8492 |
| 29 | Ga0466708_121906 | 3300042652 | Bacteria | 7706 |
| 30 | Ga0466708_213137 | 3300042652 | Unclassified | 2697 |
| 31 | Ga0466706_087379 | 3300042599 | Bacteria | 18943 |
| 32 | Ga0466713_027578 | 3300042602 | Bacteria | 1397 |
| 33 | Ga0466705_192026 | 3300042612 | Unclassified | 6380 |
| 34 | Ga0466699_160540 | 3300042597 | Unclassified | 2361 |
| 35 | Ga0123356_10037819 | 3300010049 | Bacteria | 4500 |
| 36 | Ga0123353_10018628 | 3300010167 | Bacteria | 10273 |
| 37 | Ga0466711_077314 | 3300042615 | Bacteria | 6016 |
| 38 | Ga0466711_219336 | 3300042615 | Bacteria | 2836 |
| 39 | Ga0466711_511827 | 3300042615 | Bacteria | 7235 |
| 40 | Ga0466715_052710 | 3300042616 | Bacteria | 76160 |
| 41 | Ga0466723_219366 | 3300042618 | Bacteria | 3311 |
| 42 | Ga0466723_364183 | 3300042618 | Bacteria | 7041 |
| 43 | Ga0068305_10087089 | 3300005083 | Bacteria | 21067 |
| 44 | Ga0466735_164315 | 3300042624 | Unclassified | 1426 |
| 45 | Ga0466703_091497 | 3300042636 | Bacteria | 4821 |
| 46 | Ga0466704_133420 | 3300042643 | Bacteria | 18220 |
| 47 | Ga0466709_393295 | 3300042648 | Bacteria | 11437 |
| 48 | Ga0466727_184974 | 3300042655 | Bacteria | 7833 |
| 49 | Ga0466727_195673 | 3300042655 | Bacteria | 15830 |
| 50 | Ga0466716_051855 | 3300042605 | Bacteria | 5225 |
| 51 | Ga0466716_147493 | 3300042605 | Bacteria | 2491 |
| 52 | Ga0466716_246630 | 3300042605 | Bacteria | 4295 |
| 53 | Ga0466719_076378 | 3300042606 | Bacteria | 8093 |
| 54 | Ga0466719_264689 | 3300042606 | Bacteria | 6993 |
| 55 | Ga0466722_020741 | 3300042609 | Bacteria | 1368 |
| 56 | Ga0466698_244392 | 3300042610 | Bacteria | 2474 |
| 57 | Ga0466705_103599 | 3300042612 | Bacteria | 12828 |
| 58 | Ga0466690_111128 | 3300042590 | Bacteria | 5757 |
| 59 | Ga0466690_328233 | 3300042590 | Unclassified | 4275 |
| 60 | Ga0466690_424200 | 3300042590 | Bacteria | 3335 |
| 61 | Ga0466692_180232 | 3300042591 | Bacteria | 17562 |
| 62 | Ga0466696_173051 | 3300042596 | Unclassified | 5115 |
| 63 | Ga0123355_10034597 | 3300009826 | Unclassified | 8214 |
| 64 | Ga0466715_219712 | 3300042616 | Bacteria | 4033 |
| 65 | Ga0466723_135869 | 3300042618 | Bacteria | 11379 |
| 66 | Ga0466723_171814 | 3300042618 | Bacteria | 39604 |
| 67 | Ga0466723_361590 | 3300042618 | Bacteria | 3864 |
| 68 | Ga0466728_067475 | 3300042620 | Bacteria | 3127 |
| 69 | Ga0466735_115096 | 3300042624 | Bacteria | 3578 |
| 70 | Ga0466709_286039 | 3300042648 | Bacteria | 5662 |
| 71 | Ga0466705_063549 | 3300042612 | Bacteria | 3020 |
| 72 | Ga0415639_073844 | 3300038395 | Bacteria | 1773 |
| 73 | Ga0466690_121706 | 3300042590 | Bacteria | 67510 |
| 74 | Ga0466692_202197 | 3300042591 | Bacteria | 80474 |
| 75 | Ga0466696_202422 | 3300042596 | Bacteria | 9593 |
| 76 | Ga0466696_305521 | 3300042596 | Bacteria | 23613 |
| 77 | Ga0123353_10001817 | 3300010167 | Bacteria | 26257 |
| 78 | Ga0123353_10002747 | 3300010167 | Bacteria | 21955 |
| 79 | Ga0123353_10023412 | 3300010167 | Bacteria | 9350 |
| 80 | Ga0123353_10116793 | 3300010167 | Bacteria | 4293 |
| 81 | Ga0123353_10194171 | 3300010167 | Bacteria | 3201 |
| 82 | Ga0466711_023522 | 3300042615 | Bacteria | 3968 |
| 83 | Ga0466723_260044 | 3300042618 | Unclassified | 10323 |
| 84 | Ga0466728_048749 | 3300042620 | Bacteria | 4251 |
| 85 | JGI24702J35022_10010554 | 3300002462 | Bacteria | 5158 |
| 86 | Ga0466735_118918 | 3300042624 | Bacteria | 1863 |
| 87 | Ga0466709_010192 | 3300042648 | Bacteria | 10835 |
| 88 | Ga0466727_120975 | 3300042655 | Unclassified | 17072 |
| 89 | Ga0466707_098630 | 3300042601 | Bacteria | 2282 |
| 90 | Ga0466707_220394 | 3300042601 | Bacteria | 2203 |
| 91 | Ga0466716_271829 | 3300042605 | Bacteria | 4404 |
| 92 | Ga0466719_037365 | 3300042606 | Bacteria | 7204 |
| 93 | Ga0466722_149183 | 3300042609 | Bacteria | 5250 |
| 94 | Ga0466722_175521 | 3300042609 | Bacteria | 2680 |
| 95 | Ga0466705_321362 | 3300042612 | Bacteria | 4553 |
| 96 | Ga0466693_360885 | 3300042592 | Bacteria | 1728 |
| 97 | Ga0466695_254812 | 3300042595 | Bacteria | 3082 |
| 98 | Ga0466696_079428 | 3300042596 | Bacteria | 2088 |
| 99 | Ga0123353_10002690 | 3300010167 | Bacteria | 22148 |
| 100 | Ga0123353_10003264 | 3300010167 | Bacteria | 20470 |
| 101 | Ga0123353_10018876 | 3300010167 | Bacteria | 10219 |
| 102 | Ga0466718_015822 | 3300042617 | Bacteria | 9482 |
| 103 | Ga0466723_052437 | 3300042618 | Bacteria | 33868 |
| 104 | Ga0466723_128718 | 3300042618 | Bacteria | 16666 |
| 105 | Ga0466723_212304 | 3300042618 | Unclassified | 23653 |
| 106 | Ga0466726_220005 | 3300042619 | Bacteria | 2150 |
| 107 | Ga0466726_331352 | 3300042619 | Bacteria | 1804 |
| 108 | Ga0466728_052660 | 3300042620 | Bacteria | 10231 |
| 109 | JGI24695J34938_10006985 | 3300002450 | Bacteria | 6691 |
| 110 | Ga0072941_1104951 | 3300005201 | Bacteria | 17552 |
| 111 | Ga0466702_337227 | 3300042635 | Bacteria | 1696 |
| 112 | Ga0466703_167076 | 3300042636 | Bacteria | 4342 |
| 113 | Ga0466703_423403 | 3300042636 | Bacteria | 132694 |
| 114 | Ga0466704_052120 | 3300042643 | Bacteria | 11883 |
| 115 | Ga0466708_040155 | 3300042652 | Bacteria | 3662 |
| 116 | Ga0466707_262011 | 3300042601 | Bacteria | 1418 |
| 117 | Ga0466713_035904 | 3300042602 | Bacteria | 5576 |
| 118 | Ga0466713_078267 | 3300042602 | Bacteria | 4498 |
| 119 | Ga0466713_135795 | 3300042602 | Bacteria | 36705 |
| 120 | Ga0466732_300370 | 3300042656 | Bacteria | 1853 |
| 121 | Ga0160434_101265 | 3300012850 | Unclassified | 4911 |
| 122 | Ga0466690_140177 | 3300042590 | Bacteria | 66755 |
| 123 | Ga0466691_074743 | 3300042593 | Unclassified | 2450 |
| 124 | Ga0466696_221663 | 3300042596 | Bacteria | 20321 |
| 125 | Ga0123356_10001657 | 3300010049 | Bacteria | 24369 |
| 126 | Ga0123353_10001824 | 3300010167 | Bacteria | 26202 |
| 127 | Ga0466715_136168 | 3300042616 | Bacteria | 23992 |
| 128 | Ga0466723_214421 | 3300042618 | Bacteria | 2315 |
| 129 | Ga0466726_343428 | 3300042619 | Bacteria | 6021 |
| 130 | Ga0466726_441548 | 3300042619 | Bacteria | 39085 |
| 131 | JGI24698J34947_10002698 | 3300002449 | Bacteria | 9577 |
| 132 | Ga0466731_340251 | 3300042622 | Bacteria | 1294 |
| 133 | Ga0466704_061565 | 3300042643 | Unclassified | 11080 |
| 134 | Ga0466704_293753 | 3300042643 | Bacteria | 3546 |
| 135 | Ga0466709_242859 | 3300042648 | Bacteria | 8049 |
| 136 | Ga0466708_043629 | 3300042652 | Unclassified | 1565 |
| 137 | Ga0466727_329608 | 3300042655 | Bacteria | 19061 |
| 138 | Ga0466706_210135 | 3300042599 | Bacteria | 3338 |
| 139 | Ga0466713_082859 | 3300042602 | Bacteria | 3398 |
| 140 | Ga0466713_127906 | 3300042602 | Bacteria | 4192 |
| 141 | Ga0466716_094012 | 3300042605 | Bacteria | 1745 |
| 142 | Ga0466716_392770 | 3300042605 | Unclassified | 5624 |
| 143 | Ga0466719_071256 | 3300042606 | Bacteria | 12912 |
| 144 | Ga0466719_525657 | 3300042606 | Bacteria | 30104 |
| 145 | Ga0466722_084229 | 3300042609 | Bacteria | 96990 |
| 146 | Ga0466696_152798 | 3300042596 | Bacteria | 1715 |
| 147 | Ga0123353_10003749 | 3300010167 | Bacteria | 19343 |
| 148 | Ga0466711_170116 | 3300042615 | Bacteria | 14512 |
| 149 | Ga0466711_284996 | 3300042615 | Bacteria | 10578 |
| 150 | Ga0466715_137255 | 3300042616 | Bacteria | 107557 |
| 151 | Ga0466726_065503 | 3300042619 | Bacteria | 42219 |
| 152 | Ga0466726_185112 | 3300042619 | Bacteria | 38517 |
| 153 | Ga0466703_000572 | 3300042636 | Bacteria | 29739 |
| 154 | Ga0466704_159009 | 3300042643 | Bacteria | 6917 |
| 155 | Ga0466709_083419 | 3300042648 | Bacteria | 49529 |
| 156 | Ga0466707_163658 | 3300042601 | Bacteria | 2799 |
| 157 | Ga0466707_257734 | 3300042601 | Bacteria | 6879 |
| 158 | Ga0466713_007858 | 3300042602 | Unclassified | 1959 |
| 159 | Ga0466713_013713 | 3300042602 | Bacteria | 305540 |
| 160 | Ga0466713_098200 | 3300042602 | Bacteria | 22626 |
| 161 | Ga0466716_234278 | 3300042605 | Bacteria | 2069 |
| 162 | Ga0466719_570958 | 3300042606 | Bacteria | 3044 |
| 163 | Ga0466722_213587 | 3300042609 | Bacteria | 3283 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00202 | Aminotran_3 | Aminotransferase class-III | 66 | 418 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.