Protein Family IF06852
Metagenome
Isolate
143
Members
44
Samples
135
Scaffolds
192.36
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_174060|Ga0466722_174060_107_739
- Length
- 210 aa
- Sequence
- MTARRKIVKTTRLYRVKIQVNNFKFDEKKAQKAIKLLLEAFGEDLNREGIKRTPERVAEFYKEALSGNETDPMKIVKAHYSTEDHEEIVLVKDIPFYSLCEHHLLPFFGKAHIAYIPKKDKILGVSKLIRLVEVFANRLQLQERLTKQVADTVMKAASPHGVMVVLEAEHLCMTMRGVKKPGSAMITSAMRGAFLNDVRTRSEAMSLLRR
Sample Types
Isolate
5.6%
Metagenome
94.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.5%
Unclassified
25.0%
Termitidae
25.0%
Termopsidae
9.1%
Rhinotermitidae
6.8%
Hodotermitidae
2.3%
Passalidae
2.3%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 24 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 34 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_029222 | 3300042612 | Bacteria | 3293 |
| 2 | Ga0466705_118244 | 3300042612 | Unclassified | 1935 |
| 3 | Ga0466711_420457 | 3300042615 | Bacteria | 1284 |
| 4 | Ga0466715_136727 | 3300042616 | Bacteria | 19915 |
| 5 | Ga0466715_386474 | 3300042616 | Bacteria | 5235 |
| 6 | Ga0466715_455686 | 3300042616 | Unclassified | 18710 |
| 7 | Ga0466723_092663 | 3300042618 | Bacteria | 16842 |
| 8 | Ga0466723_137137 | 3300042618 | Bacteria | 99723 |
| 9 | Ga0466723_174309 | 3300042618 | Bacteria | 23145 |
| 10 | Ga0466726_047707 | 3300042619 | Bacteria | 62318 |
| 11 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 12 | Ga0466728_407609 | 3300042620 | Bacteria | 161023 |
| 13 | Ga0123357_10079602 | 3300009784 | Bacteria | 4313 |
| 14 | Ga0123354_10004143 | 3300010882 | Bacteria | 20426 |
| 15 | Ga0123354_10250491 | 3300010882 | Bacteria | 1796 |
| 16 | Ga0466690_277657 | 3300042590 | Bacteria | 1465 |
| 17 | Ga0466690_364163 | 3300042590 | Bacteria | 2970 |
| 18 | Ga0466735_031074 | 3300042624 | Bacteria | 7424 |
| 19 | Ga0466735_077583 | 3300042624 | Bacteria | 8975 |
| 20 | Ga0466735_105429 | 3300042624 | Bacteria | 12687 |
| 21 | Ga0466704_436722 | 3300042643 | Bacteria | 1963 |
| 22 | Ga0466708_212741 | 3300042652 | Bacteria | 8594 |
| 23 | Ga0466727_110368 | 3300042655 | Bacteria | 37113 |
| 24 | Ga0466727_113548 | 3300042655 | Bacteria | 37011 |
| 25 | Ga0466713_098117 | 3300042602 | Bacteria | 46618 |
| 26 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 27 | Ga0466719_251756 | 3300042606 | Bacteria | 32914 |
| 28 | Ga0466733_059309 | 3300042659 | Bacteria | 3731 |
| 29 | Ga0466711_156110 | 3300042615 | Bacteria | 2520 |
| 30 | Ga0466711_182939 | 3300042615 | Bacteria | 3607 |
| 31 | Ga0466711_316789 | 3300042615 | Bacteria | 24132 |
| 32 | Ga0466715_436492 | 3300042616 | Bacteria | 169505 |
| 33 | Ga0466723_320209 | 3300042618 | Unclassified | 18724 |
| 34 | Ga0466690_094693 | 3300042590 | Bacteria | 13567 |
| 35 | Ga0466729_204438 | 3300042621 | Bacteria | 4524 |
| 36 | Ga0466729_212901 | 3300042621 | Bacteria | 60514 |
| 37 | Ga0466735_053842 | 3300042624 | Unclassified | 1721 |
| 38 | Ga0466703_193745 | 3300042636 | Bacteria | 23729 |
| 39 | Ga0466704_153137 | 3300042643 | Bacteria | 6843 |
| 40 | Ga0466704_437045 | 3300042643 | Bacteria | 69533 |
| 41 | Ga0466704_542960 | 3300042643 | Bacteria | 13055 |
| 42 | Ga0466727_041865 | 3300042655 | Bacteria | 123201 |
| 43 | Ga0466707_096821 | 3300042601 | Bacteria | 9354 |
| 44 | Ga0466707_416200 | 3300042601 | Bacteria | 107497 |
| 45 | Ga0466714_064049 | 3300042603 | Bacteria | 1253 |
| 46 | JGI24705J35276_12238685 | 3300002504 | Bacteria | 37084 |
| 47 | Ga0068302_10004013 | 3300005071 | Bacteria | 13558 |
| 48 | Ga0466711_004507 | 3300042615 | Bacteria | 13004 |
| 49 | Ga0466711_200800 | 3300042615 | Bacteria | 96997 |
| 50 | Ga0466726_371377 | 3300042619 | Bacteria | 11548 |
| 51 | Ga0123355_10084886 | 3300009826 | Bacteria | 5041 |
| 52 | Ga0466691_115759 | 3300042593 | Bacteria | 6802 |
| 53 | Ga0466735_018416 | 3300042624 | Bacteria | 2270 |
| 54 | Ga0466735_055759 | 3300042624 | Unclassified | 3391 |
| 55 | Ga0466735_190209 | 3300042624 | Bacteria | 3703 |
| 56 | Ga0466703_085188 | 3300042636 | Bacteria | 2766 |
| 57 | Ga0466704_310411 | 3300042643 | Unclassified | 3601 |
| 58 | Ga0466727_119530 | 3300042655 | Bacteria | 3830 |
| 59 | JGI24702J35022_10001458 | 3300002462 | Bacteria | 14717 |
| 60 | Ga0068305_10000485 | 3300005083 | Bacteria | 24190 |
| 61 | Ga0068305_10606681 | 3300005083 | Bacteria | 1273 |
| 62 | Ga0466715_028990 | 3300042616 | Bacteria | 46691 |
| 63 | Ga0466715_362667 | 3300042616 | Bacteria | 43911 |
| 64 | Ga0466723_087788 | 3300042618 | Bacteria | 16099 |
| 65 | Ga0466726_256974 | 3300042619 | Unclassified | 2525 |
| 66 | Ga0466726_326485 | 3300042619 | Bacteria | 2933 |
| 67 | Ga0466728_043696 | 3300042620 | Bacteria | 49439 |
| 68 | Ga0123357_10010886 | 3300009784 | Bacteria | 11608 |
| 69 | Ga0123356_10864230 | 3300010049 | Bacteria | 1076 |
| 70 | Ga0466734_055737 | 3300042623 | Bacteria | 4711 |
| 71 | Ga0466704_457911 | 3300042643 | Bacteria | 2855 |
| 72 | Ga0466706_225632 | 3300042599 | Bacteria | 47845 |
| 73 | Ga0466707_414585 | 3300042601 | Bacteria | 1456 |
| 74 | Ga0466717_024347 | 3300042604 | Bacteria | 6225 |
| 75 | Ga0466705_302107 | 3300042612 | Bacteria | 18559 |
| 76 | Ga0466711_242112 | 3300042615 | Bacteria | 12710 |
| 77 | Ga0466715_029145 | 3300042616 | Bacteria | 3062 |
| 78 | Ga0466723_276942 | 3300042618 | Bacteria | 25084 |
| 79 | Ga0466726_124472 | 3300042619 | Bacteria | 44985 |
| 80 | Ga0466690_093551 | 3300042590 | Bacteria | 10585 |
| 81 | Ga0466696_021217 | 3300042596 | Unclassified | 18765 |
| 82 | Ga0466735_069673 | 3300042624 | Bacteria | 7369 |
| 83 | Ga0466704_070455 | 3300042643 | Bacteria | 29825 |
| 84 | Ga0466704_432079 | 3300042643 | Bacteria | 7810 |
| 85 | Ga0466727_067151 | 3300042655 | Bacteria | 68251 |
| 86 | Ga0466707_074440 | 3300042601 | Bacteria | 6152 |
| 87 | Ga0466722_168434 | 3300042609 | Bacteria | 1299 |
| 88 | Ga0068305_10000188 | 3300005083 | Bacteria | 45611 |
| 89 | Ga0466711_165833 | 3300042615 | Bacteria | 10760 |
| 90 | Ga0466715_240730 | 3300042616 | Bacteria | 70518 |
| 91 | Ga0466715_285860 | 3300042616 | Bacteria | 3238 |
| 92 | Ga0466723_276653 | 3300042618 | Bacteria | 86412 |
| 93 | Ga0466726_160752 | 3300042619 | Bacteria | 59080 |
| 94 | Ga0466728_205591 | 3300042620 | Bacteria | 48931 |
| 95 | Ga0466729_173757 | 3300042621 | Bacteria | 7726 |
| 96 | Ga0466690_021590 | 3300042590 | Bacteria | 19026 |
| 97 | Ga0466690_057734 | 3300042590 | Bacteria | 12353 |
| 98 | Ga0466690_070178 | 3300042590 | Bacteria | 1391 |
| 99 | Ga0466691_018384 | 3300042593 | Unclassified | 1433 |
| 100 | Ga0466734_087976 | 3300042623 | Bacteria | 1711 |
| 101 | Ga0466735_043095 | 3300042624 | Bacteria | 17942 |
| 102 | Ga0466704_489802 | 3300042643 | Bacteria | 9836 |
| 103 | Ga0466713_070887 | 3300042602 | Bacteria | 102768 |
| 104 | Ga0466705_103431 | 3300042612 | Bacteria | 24857 |
| 105 | Ga0466705_254108 | 3300042612 | Bacteria | 39831 |
| 106 | Ga0466726_017923 | 3300042619 | Bacteria | 2221 |
| 107 | Ga0123354_10047744 | 3300010882 | Bacteria | 6521 |
| 108 | Ga0466657_168598 | 3300042582 | Bacteria | 3957 |
| 109 | Ga0466690_394871 | 3300042590 | Bacteria | 5097 |
| 110 | Ga0466729_253012 | 3300042621 | Bacteria | 26346 |
| 111 | Ga0466735_029406 | 3300042624 | Bacteria | 5182 |
| 112 | Ga0466735_040221 | 3300042624 | Unclassified | 3708 |
| 113 | Ga0466735_162217 | 3300042624 | Bacteria | 12413 |
| 114 | Ga0466707_273011 | 3300042601 | Bacteria | 24577 |
| 115 | Ga0466716_049930 | 3300042605 | Bacteria | 15998 |
| 116 | Ga0466716_175750 | 3300042605 | Bacteria | 13066 |
| 117 | Ga0466722_174060 | 3300042609 | Bacteria | 2626 |
| 118 | Ga0068305_10000079 | 3300005083 | Bacteria | 163717 |
| 119 | Ga0466705_069809 | 3300042612 | Unclassified | 9532 |
| 120 | Ga0466726_118552 | 3300042619 | Bacteria | 24998 |
| 121 | Ga0466728_106903 | 3300042620 | Bacteria | 2337 |
| 122 | Ga0466729_137190 | 3300042621 | Bacteria | 2503 |
| 123 | Ga0466692_167445 | 3300042591 | Bacteria | 20864 |
| 124 | Ga0466691_041850 | 3300042593 | Unclassified | 8887 |
| 125 | Ga0466691_175893 | 3300042593 | Bacteria | 1258 |
| 126 | Ga0466729_242997 | 3300042621 | Bacteria | 2380 |
| 127 | Ga0466735_005029 | 3300042624 | Bacteria | 29669 |
| 128 | Ga0466703_110964 | 3300042636 | Bacteria | 165564 |
| 129 | Ga0466706_031300 | 3300042599 | Bacteria | 209681 |
| 130 | Ga0466706_049350 | 3300042599 | Bacteria | 42213 |
| 131 | Ga0466722_032848 | 3300042609 | Bacteria | 2603 |
| 132 | 2227605754 | 2225789004 | Bacteria | 2299 |
| 133 | Ga0068302_10018799 | 3300005071 | Unclassified | 6685 |
| 134 | Ga0068302_10135722 | 3300005071 | Bacteria | 2521 |
| 135 | Ga0068305_10000176 | 3300005083 | Bacteria | 51323 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01227 | GTP_cyclohydroI | GTP cyclohydrolase I | 31 | 208 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.