Protein Family IF06849
Metagenome
Isolate
137
Members
63
Samples
118
Scaffolds
392.17
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_170101|Ga0466722_170101_2657_3934
- Length
- 425 aa
- Sequence
- MRGHGKKPASTTFYAKTDFWSNVGLKGEKTMILDKIFQLMGEKQASDIFISAGAPINIKIQGISLPVNQQIMTPSMIEKVAYELMTPKQAKTFEVSKEMNLFYSVTGLGNFRINIFRQRASISIVVRYILGRIPSLDTLNLPSILPDLIMEKRGLILVTGSTGSGKSTTIAAMLDHRNANQTGHILTIEDPIEFLFRHKKSIVNQRELGMDTLGWEHALKNAMRQAPDCILIGEIRDRETMQAAISYAQSGHLCLATLHANNSYHALNRIINFFPLENRTSLYLDLSACLKAIISQRLVRKIDGKRIPCAEILLNTLHIQELIAKGDILSIREAMEQSLAPDSQTFEQDLFRLYKEGTITIDEALTNSDSPTNLSWLINNSSDAPQHPGKPVTDLPFSEINVSGTSFKAFTLNFDEESRVEQNAA
Sample Types
Isolate
13.9%
Metagenome
86.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.0%
Termitidae
27.4%
Kalotermitidae
22.6%
Termopsidae
6.5%
Rhinotermitidae
4.8%
Formicidae
4.8%
Elmidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 2 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 3 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 16 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 17 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 22 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 34 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 35 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 38 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 41 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 42 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 43 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 44 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 52 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_234824 | 3300042612 | Bacteria | 7151 |
| 2 | Ga0466707_296704 | 3300042601 | Bacteria | 12116 |
| 3 | Ga0466716_438613 | 3300042605 | Unclassified | 1226 |
| 4 | Ga0123356_10078924 | 3300010049 | Bacteria | 3108 |
| 5 | JGI24702J35022_10003708 | 3300002462 | Bacteria | 9188 |
| 6 | JGI24702J35022_10003761 | 3300002462 | Bacteria | 9120 |
| 7 | JGI24705J35276_12236362 | 3300002504 | Unclassified | 7909 |
| 8 | Ga0072941_1189926 | 3300005201 | Bacteria | 12803 |
| 9 | Ga0123357_10000840 | 3300009784 | Bacteria | 31229 |
| 10 | Ga0466690_177200 | 3300042590 | Bacteria | 28135 |
| 11 | Ga0466692_105856 | 3300042591 | Bacteria | 36933 |
| 12 | Ga0466696_084066 | 3300042596 | Bacteria | 4455 |
| 13 | Ga0466708_051209 | 3300042652 | Bacteria | 6443 |
| 14 | Ga0466725_424414 | 3300042654 | Bacteria | 7366 |
| 15 | Ga0466729_015681 | 3300042621 | Bacteria | 43972 |
| 16 | Ga0466707_301059 | 3300042601 | Bacteria | 29327 |
| 17 | Ga0466713_107714 | 3300042602 | Bacteria | 8973 |
| 18 | Ga0466719_089617 | 3300042606 | Bacteria | 27723 |
| 19 | Ga0123353_10207008 | 3300010167 | Bacteria | 3081 |
| 20 | Ga0123354_10000684 | 3300010882 | Bacteria | 36048 |
| 21 | Ga0102734_1017847 | 3300007129 | Bacteria | 1740 |
| 22 | Ga0466657_296096 | 3300042582 | Bacteria | 2444 |
| 23 | Ga0466702_142510 | 3300042635 | Bacteria | 7061 |
| 24 | Ga0466703_023508 | 3300042636 | Bacteria | 9396 |
| 25 | Ga0466704_426686 | 3300042643 | Bacteria | 34793 |
| 26 | Ga0466704_576904 | 3300042643 | Bacteria | 2999 |
| 27 | Ga0466709_152709 | 3300042648 | Bacteria | 8494 |
| 28 | Ga0466725_172860 | 3300042654 | Bacteria | 5614 |
| 29 | Ga0466711_184150 | 3300042615 | Bacteria | 3402 |
| 30 | Ga0466711_359037 | 3300042615 | Bacteria | 49677 |
| 31 | Ga0466715_321341 | 3300042616 | Bacteria | 31269 |
| 32 | Ga0466729_058012 | 3300042621 | Bacteria | 9532 |
| 33 | Ga0466729_072556 | 3300042621 | Bacteria | 9913 |
| 34 | Ga0466733_153306 | 3300042659 | Bacteria | 32113 |
| 35 | Ga0466719_051666 | 3300042606 | Bacteria | 9917 |
| 36 | Ga0466722_156264 | 3300042609 | Bacteria | 4502 |
| 37 | Ga0072941_1012140 | 3300005201 | Bacteria | 22777 |
| 38 | Ga0466691_167641 | 3300042593 | Bacteria | 5186 |
| 39 | Ga0466696_181990 | 3300042596 | Bacteria | 7244 |
| 40 | Ga0466735_115387 | 3300042624 | Bacteria | 2865 |
| 41 | Ga0466703_174532 | 3300042636 | Bacteria | 30809 |
| 42 | Ga0466708_435232 | 3300042652 | Bacteria | 9313 |
| 43 | Ga0466710_181391 | 3300042613 | Bacteria | 2223 |
| 44 | Ga0466723_136737 | 3300042618 | Unclassified | 13873 |
| 45 | Ga0466726_045842 | 3300042619 | Bacteria | 1721 |
| 46 | Ga0466706_149105 | 3300042599 | Bacteria | 3833 |
| 47 | Ga0466707_154822 | 3300042601 | Bacteria | 6281 |
| 48 | Ga0466716_202338 | 3300042605 | Bacteria | 7569 |
| 49 | Ga0466719_203114 | 3300042606 | Bacteria | 5517 |
| 50 | Ga0466719_210698 | 3300042606 | Unclassified | 7105 |
| 51 | Ga0466719_395040 | 3300042606 | Bacteria | 5512 |
| 52 | Ga0123357_10002008 | 3300009784 | Bacteria | 22306 |
| 53 | Ga0466735_218782 | 3300042624 | Bacteria | 1260 |
| 54 | Ga0466703_115902 | 3300042636 | Bacteria | 2247 |
| 55 | Ga0466709_012927 | 3300042648 | Bacteria | 10506 |
| 56 | Ga0466708_034245 | 3300042652 | Bacteria | 25211 |
| 57 | Ga0466708_204336 | 3300042652 | Bacteria | 6983 |
| 58 | Ga0466708_251180 | 3300042652 | Bacteria | 15531 |
| 59 | Ga0466708_327201 | 3300042652 | Bacteria | 7264 |
| 60 | Ga0466710_315191 | 3300042613 | Bacteria | 2130 |
| 61 | Ga0466715_486078 | 3300042616 | Bacteria | 17131 |
| 62 | Ga0466717_078302 | 3300042604 | Bacteria | 5987 |
| 63 | Ga0466721_211392 | 3300042608 | Bacteria | 23167 |
| 64 | Ga0466722_151500 | 3300042609 | Bacteria | 2919 |
| 65 | Ga0466722_170101 | 3300042609 | Bacteria | 9003 |
| 66 | Ga0123356_10016494 | 3300010049 | Bacteria | 7044 |
| 67 | Ga0123353_10032820 | 3300010167 | Bacteria | 8071 |
| 68 | Ga0123354_10000081 | 3300010882 | Bacteria | 72300 |
| 69 | Ga0102740_1004779 | 3300007140 | Bacteria | 2640 |
| 70 | Ga0102737_1000278 | 3300007142 | Bacteria | 17271 |
| 71 | Ga0466690_009299 | 3300042590 | Bacteria | 6437 |
| 72 | Ga0466690_346309 | 3300042590 | Bacteria | 9609 |
| 73 | Ga0466691_087850 | 3300042593 | Unclassified | 7945 |
| 74 | Ga0466709_083675 | 3300042648 | Bacteria | 3326 |
| 75 | Ga0466711_277226 | 3300042615 | Bacteria | 3594 |
| 76 | Ga0466705_304848 | 3300042612 | Bacteria | 36073 |
| 77 | Ga0466701_092574 | 3300042598 | Bacteria | 8610 |
| 78 | Ga0466719_087102 | 3300042606 | Bacteria | 2458 |
| 79 | Ga0415639_155627 | 3300038395 | Bacteria | 5158 |
| 80 | Ga0466656_329481 | 3300042550 | Bacteria | 2386 |
| 81 | Ga0466657_086731 | 3300042582 | Bacteria | 6203 |
| 82 | Ga0466657_137725 | 3300042582 | Bacteria | 60772 |
| 83 | Ga0466657_161237 | 3300042582 | Bacteria | 13764 |
| 84 | Ga0466690_008529 | 3300042590 | Bacteria | 1896 |
| 85 | Ga0466696_259906 | 3300042596 | Bacteria | 1849 |
| 86 | Ga0466727_128668 | 3300042655 | Bacteria | 3776 |
| 87 | Ga0466712_167070 | 3300042614 | Bacteria | 6094 |
| 88 | Ga0466715_034383 | 3300042616 | Bacteria | 1786 |
| 89 | Ga0466715_202160 | 3300042616 | Bacteria | 9104 |
| 90 | Ga0466723_072694 | 3300042618 | Bacteria | 28050 |
| 91 | Ga0466713_047949 | 3300042602 | Bacteria | 2278 |
| 92 | Ga0123356_10089923 | 3300010049 | Bacteria | 2922 |
| 93 | Ga0123356_10364038 | 3300010049 | Bacteria | 1574 |
| 94 | Ga0123354_10053250 | 3300010882 | Bacteria | 6087 |
| 95 | Ga0072941_1111542 | 3300005201 | Bacteria | 12790 |
| 96 | Ga0466692_117162 | 3300042591 | Bacteria | 24746 |
| 97 | Ga0466692_150354 | 3300042591 | Bacteria | 25586 |
| 98 | Ga0466703_408112 | 3300042636 | Bacteria | 11766 |
| 99 | Ga0466704_128168 | 3300042643 | Bacteria | 26461 |
| 100 | Ga0466708_281203 | 3300042652 | Bacteria | 40046 |
| 101 | Ga0466710_279852 | 3300042613 | Bacteria | 5099 |
| 102 | Ga0466710_348801 | 3300042613 | Bacteria | 54409 |
| 103 | Ga0466728_067450 | 3300042620 | Bacteria | 2009 |
| 104 | Ga0466705_009059 | 3300042612 | Bacteria | 5439 |
| 105 | Ga0466707_092161 | 3300042601 | Unclassified | 8179 |
| 106 | Ga0466707_128695 | 3300042601 | Bacteria | 21572 |
| 107 | Ga0466719_425966 | 3300042606 | Bacteria | 2264 |
| 108 | Ga0123356_10000182 | 3300010049 | Bacteria | 71892 |
| 109 | Ga0068302_10056959 | 3300005071 | Bacteria | 4109 |
| 110 | Ga0072941_1312252 | 3300005201 | Bacteria | 2001 |
| 111 | Ga0123357_10000003 | 3300009784 | Bacteria | 349727 |
| 112 | Ga0466691_047915 | 3300042593 | Bacteria | 9383 |
| 113 | Ga0466735_201589 | 3300042624 | Bacteria | 3349 |
| 114 | Ga0466708_258890 | 3300042652 | Bacteria | 8017 |
| 115 | Ga0466723_020513 | 3300042618 | Bacteria | 8101 |
| 116 | Ga0466726_269311 | 3300042619 | Bacteria | 8214 |
| 117 | Ga0466726_401106 | 3300042619 | Bacteria | 9199 |
| 118 | Ga0466728_270227 | 3300042620 | Bacteria | 28359 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00437 | T2SSE | Type II/IV secretion system protein | 143 | 301 | 0.71 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.