Protein Family IF06842
Metagenome
Isolate
205
Members
81
Samples
161
Scaffolds
397.12
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_160383|Ga0466722_160383_15880_17160
- Length
- 426 aa
- Sequence
- MPEHTVHPDRHFLCLAGNVRKQNKITSQMKEIATDIYYVGVNDRRKTLFENLWPLPHGVSYNSFLIVDGKTALIDTVDISYSDFFFRKVEQALNGQPLDYLVVNHMEPDHAGSIRLLRQLYPDVRIVGNRQTFGMLAGYHGITDGLYEVKDGDCLDLGRRRLTFYMAPMVHWPEVMVAYEETEKILFSADAFGTYGTLDGGITDSEMNAGKFWDEMIRYYANIVGKYGNPVQKILQKMAAFDIHTICSTHGPVWKKHAAKAIDMYDRLSRYEGEKGVTIIYGSMYGHTEQMAEIIAASLSDNGIRDIVLYDASKTHASYLLRDIFRYKGLMIGSPTYSAHLFPAIDALLEKIEVREVKNRLFGYFGSFTWAGVAVKRLATFAETMKWETVGEPVEQKQGMSSETYDKCRKLGEAMAKRLNEDHPAC
Sample Types
Isolate
21.5%
Metagenome
78.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
42.0%
Kalotermitidae
17.3%
Termitidae
14.8%
Unclassified
11.1%
Rhinotermitidae
4.9%
Termopsidae
3.7%
Hydrophilidae
2.5%
Hodotermitidae
1.2%
Passalidae
1.2%
Tenebrionidae
1.2%
Taxonomy
Archaea
0
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 2 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 3 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 4 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 5 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 12 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 13 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 14 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 25 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 26 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 27 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 28 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 29 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 30 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 31 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 32 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 33 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 42 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 43 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 44 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 45 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 46 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 47 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 48 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 49 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 51 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 52 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 55 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 56 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 57 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 58 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 64 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 65 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 66 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 67 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 68 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 69 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 70 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 71 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 72 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 73 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 74 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 75 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 76 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 77 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 78 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 79 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 80 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 81 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10014725 | 3300009784 | Bacteria | 10221 |
| 2 | Ga0466701_077922 | 3300042598 | Bacteria | 7465 |
| 3 | Ga0466706_132477 | 3300042599 | Bacteria | 42568 |
| 4 | Ga0466713_080902 | 3300042602 | Bacteria | 29889 |
| 5 | Ga0466714_021181 | 3300042603 | Bacteria | 6434 |
| 6 | Ga0466714_042430 | 3300042603 | Bacteria | 3742 |
| 7 | Ga0466716_515772 | 3300042605 | Bacteria | 2648 |
| 8 | Ga0466710_422189 | 3300042613 | Bacteria | 8227 |
| 9 | Ga0466711_139246 | 3300042615 | Bacteria | 16057 |
| 10 | Ga0466715_400041 | 3300042616 | Bacteria | 26123 |
| 11 | Ga0466715_576563 | 3300042616 | Bacteria | 12026 |
| 12 | Ga0466723_301081 | 3300042618 | Bacteria | 11213 |
| 13 | Ga0466657_167925 | 3300042582 | Bacteria | 4490 |
| 14 | Ga0466690_268244 | 3300042590 | Bacteria | 15974 |
| 15 | Ga0466696_057822 | 3300042596 | Bacteria | 24547 |
| 16 | Ga0466735_228417 | 3300042624 | Bacteria | 15817 |
| 17 | Ga0466703_209026 | 3300042636 | Bacteria | 32874 |
| 18 | Ga0466704_485734 | 3300042643 | Bacteria | 6162 |
| 19 | Ga0466704_582225 | 3300042643 | Bacteria | 53049 |
| 20 | Ga0466709_377195 | 3300042648 | Bacteria | 5135 |
| 21 | Ga0466709_418934 | 3300042648 | Bacteria | 15673 |
| 22 | Ga0466733_031111 | 3300042659 | Bacteria | 44698 |
| 23 | Ga0466733_216132 | 3300042659 | Bacteria | 221678 |
| 24 | Ga0466700_124909 | 3300042600 | Bacteria | 3119 |
| 25 | Ga0466713_083231 | 3300042602 | Bacteria | 5224 |
| 26 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 27 | Ga0466714_057554 | 3300042603 | Bacteria | 76415 |
| 28 | Ga0466721_344366 | 3300042608 | Bacteria | 1352 |
| 29 | Ga0466722_160383 | 3300042609 | Bacteria | 27402 |
| 30 | Ga0466729_015139 | 3300042621 | Bacteria | 1621 |
| 31 | IMNBL1DRAFT_c0003025 | 3300000062 | Bacteria | 11126 |
| 32 | Ga0068305_10050200 | 3300005083 | Bacteria | 7119 |
| 33 | Ga0466690_041120 | 3300042590 | Bacteria | 21497 |
| 34 | Ga0466704_392159 | 3300042643 | Bacteria | 6781 |
| 35 | Ga0466709_301769 | 3300042648 | Bacteria | 2380 |
| 36 | Ga0466733_004812 | 3300042659 | Bacteria | 14623 |
| 37 | Ga0466733_076250 | 3300042659 | Bacteria | 2706 |
| 38 | Ga0466707_253563 | 3300042601 | Bacteria | 2585 |
| 39 | Ga0466713_020351 | 3300042602 | Bacteria | 91390 |
| 40 | Ga0466713_112916 | 3300042602 | Bacteria | 35573 |
| 41 | Ga0466714_036275 | 3300042603 | Bacteria | 31546 |
| 42 | Ga0466714_102666 | 3300042603 | Bacteria | 1321 |
| 43 | Ga0466714_151063 | 3300042603 | Bacteria | 1565 |
| 44 | Ga0466716_000217 | 3300042605 | Bacteria | 7743 |
| 45 | Ga0466719_287400 | 3300042606 | Bacteria | 6117 |
| 46 | Ga0466705_399550 | 3300042612 | Bacteria | 30994 |
| 47 | Ga0466711_333068 | 3300042615 | Bacteria | 45034 |
| 48 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 49 | Ga0466715_043557 | 3300042616 | Bacteria | 35103 |
| 50 | Ga0466715_147816 | 3300042616 | Bacteria | 16123 |
| 51 | Ga0466723_354948 | 3300042618 | Bacteria | 23912 |
| 52 | Ga0466726_055017 | 3300042619 | Bacteria | 5799 |
| 53 | Ga0466728_218127 | 3300042620 | Bacteria | 25201 |
| 54 | JGI24702J35022_10000967 | 3300002462 | Bacteria | 17950 |
| 55 | Ga0466690_269418 | 3300042590 | Bacteria | 5069 |
| 56 | Ga0466696_198724 | 3300042596 | Bacteria | 2873 |
| 57 | Ga0466696_318968 | 3300042596 | Bacteria | 11149 |
| 58 | Ga0466696_473098 | 3300042596 | Bacteria | 2038 |
| 59 | Ga0466729_285011 | 3300042621 | Bacteria | 12342 |
| 60 | Ga0466704_097022 | 3300042643 | Bacteria | 6098 |
| 61 | Ga0466704_291090 | 3300042643 | Bacteria | 7004 |
| 62 | Ga0466708_029387 | 3300042652 | Bacteria | 22724 |
| 63 | Ga0466708_434006 | 3300042652 | Bacteria | 8063 |
| 64 | Ga0466733_059911 | 3300042659 | Bacteria | 27822 |
| 65 | Ga0466701_029840 | 3300042598 | Bacteria | 102818 |
| 66 | Ga0466716_222358 | 3300042605 | Bacteria | 9643 |
| 67 | Ga0466719_388624 | 3300042606 | Bacteria | 3808 |
| 68 | Ga0466711_016038 | 3300042615 | Bacteria | 2081 |
| 69 | Ga0466711_048014 | 3300042615 | Bacteria | 2834 |
| 70 | Ga0466711_064702 | 3300042615 | Bacteria | 28145 |
| 71 | Ga0466715_107883 | 3300042616 | Bacteria | 15928 |
| 72 | Ga0466715_203254 | 3300042616 | Bacteria | 31453 |
| 73 | Ga0466729_040345 | 3300042621 | Bacteria | 4539 |
| 74 | IMNBL1DRAFT_c0014594 | 3300000062 | Bacteria | 3456 |
| 75 | JGI24702J35022_10002874 | 3300002462 | Bacteria | 10421 |
| 76 | Ga0068305_10039975 | 3300005083 | Bacteria | 13485 |
| 77 | Ga0466690_315715 | 3300042590 | Bacteria | 12562 |
| 78 | Ga0466703_177366 | 3300042636 | Unclassified | 8461 |
| 79 | Ga0466703_250877 | 3300042636 | Bacteria | 4114 |
| 80 | Ga0466703_291243 | 3300042636 | Bacteria | 10296 |
| 81 | Ga0466703_428474 | 3300042636 | Bacteria | 51998 |
| 82 | Ga0466704_010042 | 3300042643 | Bacteria | 4960 |
| 83 | Ga0466704_016474 | 3300042643 | Bacteria | 1866 |
| 84 | Ga0466704_042167 | 3300042643 | Bacteria | 13084 |
| 85 | Ga0466733_114046 | 3300042659 | Bacteria | 9836 |
| 86 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 87 | Ga0466706_027345 | 3300042599 | Bacteria | 2739 |
| 88 | Ga0466706_112132 | 3300042599 | Bacteria | 5535 |
| 89 | Ga0466706_140786 | 3300042599 | Bacteria | 4866 |
| 90 | Ga0466706_156929 | 3300042599 | Bacteria | 8374 |
| 91 | Ga0466716_125911 | 3300042605 | Bacteria | 3273 |
| 92 | Ga0466716_321997 | 3300042605 | Bacteria | 2383 |
| 93 | Ga0466716_528684 | 3300042605 | Bacteria | 22222 |
| 94 | Ga0466719_008982 | 3300042606 | Bacteria | 2229 |
| 95 | Ga0466722_048373 | 3300042609 | Bacteria | 17703 |
| 96 | Ga0466711_212398 | 3300042615 | Bacteria | 10673 |
| 97 | Ga0466715_113213 | 3300042616 | Bacteria | 91663 |
| 98 | Ga0466703_197916 | 3300042636 | Bacteria | 14155 |
| 99 | Ga0466704_093311 | 3300042643 | Bacteria | 21533 |
| 100 | Ga0466708_052688 | 3300042652 | Bacteria | 18489 |
| 101 | Ga0466727_071200 | 3300042655 | Bacteria | 9346 |
| 102 | Ga0466727_112825 | 3300042655 | Bacteria | 14983 |
| 103 | Ga0466697_082893 | 3300042611 | Bacteria | 90149 |
| 104 | Ga0466705_145712 | 3300042612 | Bacteria | 12966 |
| 105 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 106 | Ga0466733_083799 | 3300042659 | Bacteria | 6761 |
| 107 | Ga0466733_113201 | 3300042659 | Bacteria | 3814 |
| 108 | Ga0466706_022233 | 3300042599 | Bacteria | 15605 |
| 109 | Ga0466706_277362 | 3300042599 | Bacteria | 17411 |
| 110 | Ga0466707_241195 | 3300042601 | Bacteria | 11794 |
| 111 | Ga0466713_063067 | 3300042602 | Bacteria | 116971 |
| 112 | Ga0466714_059670 | 3300042603 | Bacteria | 2108 |
| 113 | Ga0466714_144330 | 3300042603 | Bacteria | 3608 |
| 114 | Ga0466722_111472 | 3300042609 | Bacteria | 10577 |
| 115 | Ga0466705_439321 | 3300042612 | Bacteria | 8301 |
| 116 | Ga0466715_594329 | 3300042616 | Bacteria | 8037 |
| 117 | Ga0466726_222610 | 3300042619 | Bacteria | 7867 |
| 118 | Ga0466657_367955 | 3300042582 | Bacteria | 1243 |
| 119 | Ga0466690_034492 | 3300042590 | Bacteria | 29612 |
| 120 | Ga0466696_185558 | 3300042596 | Bacteria | 17647 |
| 121 | Ga0466696_486955 | 3300042596 | Bacteria | 6545 |
| 122 | Ga0466703_055532 | 3300042636 | Bacteria | 4866 |
| 123 | Ga0466709_297589 | 3300042648 | Bacteria | 4720 |
| 124 | Ga0466733_199326 | 3300042659 | Bacteria | 2519 |
| 125 | Ga0466714_041232 | 3300042603 | Bacteria | 7273 |
| 126 | Ga0466714_071092 | 3300042603 | Bacteria | 5202 |
| 127 | Ga0466722_046557 | 3300042609 | Bacteria | 3426 |
| 128 | Ga0466711_016042 | 3300042615 | Bacteria | 2120 |
| 129 | Ga0466711_271474 | 3300042615 | Bacteria | 4229 |
| 130 | Ga0466726_367695 | 3300042619 | Bacteria | 5656 |
| 131 | Ga0466728_398132 | 3300042620 | Bacteria | 32620 |
| 132 | Ga0466729_082744 | 3300042621 | Bacteria | 9963 |
| 133 | Ga0466691_146667 | 3300042593 | Bacteria | 8924 |
| 134 | Ga0466696_152202 | 3300042596 | Bacteria | 14725 |
| 135 | Ga0466696_366791 | 3300042596 | Bacteria | 2735 |
| 136 | Ga0466735_104312 | 3300042624 | Bacteria | 1515 |
| 137 | Ga0466703_019376 | 3300042636 | Bacteria | 9082 |
| 138 | Ga0466703_115474 | 3300042636 | Bacteria | 9589 |
| 139 | Ga0466727_044359 | 3300042655 | Bacteria | 1746 |
| 140 | Ga0466727_157269 | 3300042655 | Bacteria | 5248 |
| 141 | Ga0466705_081906 | 3300042612 | Bacteria | 15318 |
| 142 | Ga0466733_023612 | 3300042659 | Bacteria | 4594 |
| 143 | Ga0466706_039709 | 3300042599 | Bacteria | 84247 |
| 144 | Ga0466706_119758 | 3300042599 | Bacteria | 63998 |
| 145 | Ga0466706_260462 | 3300042599 | Bacteria | 2936 |
| 146 | Ga0466713_016553 | 3300042602 | Bacteria | 3617 |
| 147 | Ga0466713_136049 | 3300042602 | Bacteria | 27048 |
| 148 | Ga0466713_143519 | 3300042602 | Bacteria | 40408 |
| 149 | Ga0466714_032632 | 3300042603 | Bacteria | 2080 |
| 150 | Ga0466719_162727 | 3300042606 | Bacteria | 34676 |
| 151 | Ga0466722_072085 | 3300042609 | Bacteria | 13372 |
| 152 | Ga0466722_096452 | 3300042609 | Bacteria | 12880 |
| 153 | Ga0466698_194562 | 3300042610 | Bacteria | 2490 |
| 154 | Ga0466711_124168 | 3300042615 | Bacteria | 2121 |
| 155 | Ga0466715_185934 | 3300042616 | Bacteria | 13383 |
| 156 | JGI24705J35276_12231723 | 3300002504 | Bacteria | 4044 |
| 157 | Ga0466696_001911 | 3300042596 | Bacteria | 82336 |
| 158 | Ga0466696_173071 | 3300042596 | Bacteria | 14173 |
| 159 | Ga0466704_170997 | 3300042643 | Bacteria | 16147 |
| 160 | Ga0466709_210619 | 3300042648 | Bacteria | 6017 |
| 161 | Ga0466709_309614 | 3300042648 | Bacteria | 3531 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00258 | GO:0010181 | FMN binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.