Protein Family IF06827

Metagenome Isolate
143 Members
92 Samples
94 Scaffolds
405.18 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_138423|Ga0466722_138423_324_1769
Length
481 aa
Sequence
MSGVQAAGGQESATLFSLGGKKLTAVFRVCWLGAIDAMGKELAPFSSGRSRPRPEGWSRSSSRSFRAGFQTGVGFTMTTMALQGKTILLGVSGGIAAYKAAMLTRLLKGAGARVRVAMSEAAGQFVTPLTFQALSGEAVFSSLWEAGDVASGMAHITLSREADAMLVAPATADFMARAATGQADDLLSTLALARNCPLFLAPSMNRQMWRHPATQRNAATLAEDGVVIWGPTSGKQACGEDGEGRLLEPEQLLEALTAALARKTLAGKKVLLTAGPTFEAIDPVRGLTNRSSGKMGYALARAAFHAGATVTLVSGPVAIPFPYGVTGVPVISAAEMQQAVLTRAADADIFIAVAAVADYHVKTTLTAKHKKEHGVLPTLDLVENPDILASVAALHSPPFCVGFAAESEDLARYAEEKRRRKRLPLIVGNLVQEGLGGDSNHVVLFDDHGAHALPTADKHVLARQLIDHIAALMETAHARVN

📊 Sample Types

Isolate 34.3%
Metagenome 65.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 37.4%
Termitidae 19.8%
Kalotermitidae 9.9%
Elmidae 7.7%
Tenebrionidae 5.5%
Rhinotermitidae 4.4%
Armadillidiidae 2.2%
Nephropidae 2.2%
Psyllidae 1.1%
Hodotermitidae 1.1%
Apidae 1.1%
Formicidae 1.1%
Passalidae 1.1%
Cixiidae 1.1%
Termopsidae 1.1%
Drosophilidae 1.1%
Blattidae 1.1%
Culicidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
4 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
9 2512047046 Secondary Endosymbiont of Heteropsylla cubana Isolate Psyllidae
10 2820056190 Unclassified Proteobacteria Nt197P4bin9 Isolate Unclassified
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
19 2511231129 Vibrio sp. EJY3 Isolate Unclassified
20 2820046858 Unclassified Proteobacteria Th196P3bin84 Isolate Unclassified
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
24 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
25 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
26 2864895409 Bacillus aerius S00152 Isolate Elmidae
27 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
28 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
29 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
30 2916858470 Heyndrickxia oleronia Isolate Unclassified
31 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
32 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
33 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 8064008355 Heyndrickxia oleronia Isolate Unclassified
37 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
38 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
42 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
43 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
44 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
45 2617270844 Dyella sp. HyOG Isolate Cixiidae
46 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
47 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
48 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
52 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
53 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
54 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
55 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
56 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
57 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
58 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
59 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
60 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
61 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
62 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
63 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
64 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
65 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
66 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
67 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
68 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
69 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
70 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
71 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
72 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
73 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
74 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
75 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
76 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
77 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
78 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
79 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
80 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
81 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
82 2864801025 Bacillus aerius S00042 Isolate Elmidae
83 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
84 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
85 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
86 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
87 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
88 2562617066 Rickettsiella grylli AAQJ Isolate Armadillidiidae
89 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
90 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
91 2820439761 Unclassified Firmicutes Lab288P3bin203 Isolate Unclassified
92 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_000075 3300056564 Unclassified 94291
2 Ga0466657_101788 3300042582 Unclassified 2071
3 Ga0466657_388233 3300042582 Bacteria 1531
4 Ga0466708_071550 3300042652 Bacteria 11633
5 Ga0123356_10001908 3300010049 Bacteria 22604
6 Ga0123356_10007509 3300010049 Unclassified 10869
7 Ga0466707_013970 3300042601 Bacteria 10343
8 Ga0466707_319311 3300042601 Bacteria 64740
9 Ga0466719_051112 3300042606 Bacteria 7773
10 Ga0562374_0725 3300057007 Bacteria 48750
11 Ga0466694_039124 3300042594 Bacteria 11527
12 Ga0466703_047465 3300042636 Bacteria 7955
13 Ga0466710_448377 3300042613 Bacteria 17884
14 Ga0466711_283621 3300042615 Bacteria 1562
15 Ga0466715_575106 3300042616 Bacteria 42120
16 Ga0123355_10056550 3300009826 Bacteria 6348
17 Ga0123355_10102583 3300009826 Bacteria 4499
18 Ga0123356_10138350 3300010049 Bacteria 2398
19 JGI24705J35276_12238715 3300002504 Bacteria 41934
20 Ga0466719_045544 3300042606 Bacteria 3628
21 Ga0466719_163598 3300042606 Bacteria 1863
22 Ga0562377_0106 3300056842 Bacteria 268063
23 Ga0466725_149073 3300042654 Bacteria 3594
24 Ga0466705_529595 3300042612 Bacteria 4797
25 Ga0466729_047835 3300042621 Bacteria 11017
26 Ga0123356_10000653 3300010049 Bacteria 38246
27 Ga0123356_10014214 3300010049 Bacteria 7658
28 JGI24705J35276_12235357 3300002504 Unclassified 6448
29 Ga0466701_033817 3300042598 Bacteria 21159
30 Ga0466713_038548 3300042602 Bacteria 2719
31 Ga0466719_513846 3300042606 Unclassified 3940
32 Ga0466722_173116 3300042609 Bacteria 181242
33 Ga0562379_0028 3300056790 Bacteria 775176
34 Ga0562379_0481 3300056790 Bacteria 81076
35 Ga0466724_07593 3300042649 Bacteria 2799
36 Ga0466725_461929 3300042654 Bacteria 22391
37 Ga0466710_005173 3300042613 Bacteria 12522
38 Ga0466715_019395 3300042616 Bacteria 14760
39 Ga0123355_10447638 3300009826 Bacteria 1630
40 Ga0123356_10034060 3300010049 Unclassified 4763
41 2227408574 2225789004 Bacteria 5728
42 Ga0466706_019852 3300042599 Bacteria 2689
43 Ga0466719_542886 3300042606 Bacteria 1890
44 Ga0466705_204571 3300042612 Bacteria 4582
45 Ga0466733_005264 3300042659 Bacteria 47783
46 Ga0562377_0065 3300056842 Bacteria 457525
47 Ga0160455_100003 3300012837 Bacteria 1101044
48 Ga0466734_124233 3300042623 Bacteria 8234
49 Ga0466704_420893 3300042643 Bacteria 12772
50 Ga0466725_038656 3300042654 Bacteria 30865
51 Ga0466725_136466 3300042654 Bacteria 5260
52 Ga0123355_10003063 3300009826 Unclassified 23815
53 Ga0123356_10030609 3300010049 Bacteria 5037
54 Ga0123356_10033812 3300010049 Unclassified 4781
55 Ga0123353_10034897 3300010167 Bacteria 7861
56 Ga0123354_10059183 3300010882 Unclassified 5684
57 HBC_ctgsDRAFT_1000075 3300000333 Bacteria 25451
58 JGI24705J35276_12236690 3300002504 Unclassified 8640
59 Ga0103264_1000081 3300007188 Bacteria 56731
60 Ga0466701_043277 3300042598 Bacteria 12338
61 Ga0466717_260520 3300042604 Bacteria 3462
62 Ga0466697_117188 3300042611 Bacteria 2636
63 Ga0466657_015947 3300042582 Bacteria 203876
64 Ga0466657_125491 3300042582 Bacteria 1914
65 Ga0466725_082831 3300042654 Bacteria 99829
66 Ga0466723_326243 3300042618 Bacteria 4823
67 Ga0123355_10013223 3300009826 Bacteria 12831
68 Ga0123354_10003014 3300010882 Bacteria 22929
69 JGI24705J35276_12222542 3300002504 Bacteria 2429
70 Ga0466706_033530 3300042599 Bacteria 4680
71 Ga0466722_135096 3300042609 Bacteria 33731
72 Ga0466722_138423 3300042609 Bacteria 2730
73 Ga0466657_093353 3300042582 Bacteria 11450
74 Ga0466692_175419 3300042591 Bacteria 3916
75 Ga0466726_095611 3300042619 Bacteria 13345
76 Ga0123357_10223930 3300009784 Bacteria 2080
77 Ga0123355_10003145 3300009826 Bacteria 23588
78 Ga0123355_10078842 3300009826 Bacteria 5261
79 Ga0123356_10000827 3300010049 Bacteria 34422
80 Ga0160470_100114 3300012813 Bacteria 87061
81 2212577974 2209111004 Bacteria 23753
82 Ga0466716_257372 3300042605 Bacteria 5559
83 Ga0466722_144904 3300042609 Bacteria 627430
84 Ga0466733_108906 3300042659 Bacteria 34427
85 Ga0466695_399591 3300042595 Bacteria 11961
86 Ga0466710_409417 3300042613 Bacteria 38150
87 Ga0466729_148217 3300042621 Bacteria 33223
88 Ga0123354_10010507 3300010882 Bacteria 14266
89 Ga0105524_103199 3300007733 Bacteria 2017
90 Ga0123357_10000023 3300009784 Bacteria 136176
91 Ga0466706_093890 3300042599 Bacteria 35349
92 Ga0466706_096658 3300042599 Bacteria 2237
93 Ga0466717_312584 3300042604 Bacteria 24276
94 Ga0466719_391651 3300042606 Bacteria 4007

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04127 DFP DNA / pantothenate metabolism flavoprotein 265 444 0.96
PF02441 Flavoprotein Flavoprotein 85 255 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02441 GO:0003824 catalytic activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.