Protein Family IF06809
Metagenome
Metatranscriptome
Isolate
216
Members
60
Samples
198
Scaffolds
177.33
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_114793|Ga0466722_114793_4434_5042
- Length
- 202 aa
- Sequence
- MTAPAEKPDNFGEEPPAERPFRALRGGTASGTGAALGTKISAGELDRRTAVLKRFRELLKTQRDRFQAYLESLDRQKEAIEGGRTEEVVSHVDLEEQIVADIFSIQKVIDPLEEMYRTLSPAGTGFMSPEPGEDEGVPGLKSALETLKTEAAARSERNKELLSRRMTGLKAEITALRANNPYRASRSIYAGAGTASVIDLRG
Sample Types
Isolate
8.3%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.3%
Unclassified
32.8%
Kalotermitidae
12.1%
Rhinotermitidae
3.4%
Termopsidae
3.4%
Taxonomy
Archaea
1
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 10 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 11 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 12 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 19 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 30 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 31 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 32 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 35 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 36 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 37 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 46 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 47 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 54 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 56 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 57 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 58 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 59 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_052335 | 3300042615 | Bacteria | 17868 |
| 2 | Ga0466718_057062 | 3300042617 | Bacteria | 3913 |
| 3 | Ga0466700_248376 | 3300042600 | Bacteria | 1019 |
| 4 | Ga0123357_10077402 | 3300009784 | Bacteria | 4388 |
| 5 | Ga0123355_10071978 | 3300009826 | Bacteria | 5547 |
| 6 | Ga0123356_10003203 | 3300010049 | Bacteria | 17182 |
| 7 | Ga0123356_10733356 | 3300010049 | Bacteria | 1158 |
| 8 | Ga0123356_11375689 | 3300010049 | Bacteria | 867 |
| 9 | Ga0123353_10490853 | 3300010167 | Bacteria | 1793 |
| 10 | Ga0123354_10570021 | 3300010882 | Bacteria | 844 |
| 11 | Ga0264413_108131 | 3300024493 | Bacteria | 2147 |
| 12 | Ga0415639_005276 | 3300038395 | Bacteria | 23681 |
| 13 | Ga0415639_019522 | 3300038395 | Bacteria | 13988 |
| 14 | Ga0415639_021169 | 3300038395 | Bacteria | 2197 |
| 15 | Ga0415639_150017 | 3300038395 | Unclassified | 2877 |
| 16 | Ga0466694_141947 | 3300042594 | Bacteria | 1575 |
| 17 | Ga0466699_247395 | 3300042597 | Bacteria | 1469 |
| 18 | Ga0466699_403519 | 3300042597 | Bacteria | 2108 |
| 19 | JGI24698J34947_10024013 | 3300002449 | Bacteria | 3258 |
| 20 | JGI24698J34947_10024412 | 3300002449 | Bacteria | 3228 |
| 21 | JGI24695J34938_10000096 | 3300002450 | Bacteria | 77675 |
| 22 | JGI24695J34938_10003142 | 3300002450 | Bacteria | 11763 |
| 23 | JGI24695J34938_10090091 | 3300002450 | Bacteria | 1259 |
| 24 | Ga0072941_1004938 | 3300005201 | Bacteria | 6150 |
| 25 | Ga0072941_1050313 | 3300005201 | Bacteria | 11994 |
| 26 | Ga0072941_1125804 | 3300005201 | Bacteria | 4202 |
| 27 | Ga0466729_267333 | 3300042621 | Bacteria | 1151 |
| 28 | Ga0466731_050020 | 3300042622 | Bacteria | 1500 |
| 29 | Ga0466732_002392 | 3300042656 | Unclassified | 1106 |
| 30 | Ga0466733_013483 | 3300042659 | Bacteria | 1983 |
| 31 | Ga0466719_491404 | 3300042606 | Bacteria | 2571 |
| 32 | Ga0466720_208907 | 3300042607 | Unclassified | 1183 |
| 33 | Ga0123356_11960034 | 3300010049 | Bacteria | 730 |
| 34 | Ga0123353_11468397 | 3300010167 | Bacteria | 871 |
| 35 | Ga0264413_105653 | 3300024493 | Bacteria | 17563 |
| 36 | Ga0264413_106275 | 3300024493 | Bacteria | 3591 |
| 37 | Ga0466694_115872 | 3300042594 | Bacteria | 4950 |
| 38 | Ga0466694_228107 | 3300042594 | Bacteria | 2614 |
| 39 | Ga0466699_163970 | 3300042597 | Bacteria | 2688 |
| 40 | Ga0466699_423871 | 3300042597 | Bacteria | 1053 |
| 41 | JGI24698J34947_10064016 | 3300002449 | Bacteria | 1800 |
| 42 | JGI24695J34938_10001001 | 3300002450 | Bacteria | 25675 |
| 43 | JGI24695J34938_10018540 | 3300002450 | Bacteria | 3474 |
| 44 | JGI24702J35022_10002358 | 3300002462 | Bacteria | 11552 |
| 45 | JGI24702J35022_10004187 | 3300002462 | Bacteria | 8614 |
| 46 | Ga0072940_1085263 | 3300005200 | Bacteria | 1908 |
| 47 | Ga0072941_1026582 | 3300005201 | Bacteria | 2010 |
| 48 | Ga0072941_1173498 | 3300005201 | Bacteria | 3073 |
| 49 | Ga0466702_363640 | 3300042635 | Bacteria | 1385 |
| 50 | Ga0466705_026607 | 3300042612 | Bacteria | 47022 |
| 51 | Ga0466712_008782 | 3300042614 | Bacteria | 13623 |
| 52 | Ga0466712_086061 | 3300042614 | Unclassified | 7332 |
| 53 | Ga0466712_127573 | 3300042614 | Bacteria | 29541 |
| 54 | Ga0466712_190862 | 3300042614 | Bacteria | 2632 |
| 55 | Ga0466718_165076 | 3300042617 | Bacteria | 1766 |
| 56 | Ga0466726_421108 | 3300042619 | Bacteria | 1654 |
| 57 | Ga0466717_067260 | 3300042604 | Bacteria | 1028 |
| 58 | Ga0466719_249496 | 3300042606 | Bacteria | 1500 |
| 59 | Ga0466720_159737 | 3300042607 | Bacteria | 1747 |
| 60 | Ga0466720_177730 | 3300042607 | Bacteria | 2135 |
| 61 | Ga0466698_182086 | 3300042610 | Bacteria | 27947 |
| 62 | Ga0466698_294509 | 3300042610 | Bacteria | 1132 |
| 63 | Ga0123356_10011992 | 3300010049 | Bacteria | 8434 |
| 64 | Ga0123356_10032913 | 3300010049 | Bacteria | 4848 |
| 65 | Ga0123356_10519838 | 3300010049 | Bacteria | 1348 |
| 66 | Ga0123356_10891671 | 3300010049 | Bacteria | 1061 |
| 67 | Ga0123356_12930046 | 3300010049 | Bacteria | 596 |
| 68 | Ga0264413_107400 | 3300024493 | Bacteria | 71506 |
| 69 | Ga0466694_319566 | 3300042594 | Bacteria | 2574 |
| 70 | AustNasuHG_c1000079 | 3300000089 | Bacteria | 27646 |
| 71 | JGI24698J34947_10017229 | 3300002449 | Bacteria | 3918 |
| 72 | JGI24698J34947_10045323 | 3300002449 | Bacteria | 2245 |
| 73 | JGI24695J34938_10006863 | 3300002450 | Bacteria | 6760 |
| 74 | JGI24695J34938_10064411 | 3300002450 | Bacteria | 1551 |
| 75 | Ga0072940_1013695 | 3300005200 | Bacteria | 3854 |
| 76 | Ga0466702_107340 | 3300042635 | Unclassified | 3050 |
| 77 | Ga0466702_332499 | 3300042635 | Bacteria | 2236 |
| 78 | Ga0466709_294804 | 3300042648 | Bacteria | 2018 |
| 79 | Ga0466732_292079 | 3300042656 | Bacteria | 3490 |
| 80 | Ga0466712_084399 | 3300042614 | Bacteria | 8367 |
| 81 | Ga0466712_162682 | 3300042614 | Bacteria | 15028 |
| 82 | Ga0466707_409087 | 3300042601 | Bacteria | 1040 |
| 83 | Ga0466721_202594 | 3300042608 | Bacteria | 33171 |
| 84 | Ga0466698_028437 | 3300042610 | Bacteria | 1756 |
| 85 | Ga0123356_10007005 | 3300010049 | Bacteria | 11319 |
| 86 | Ga0123353_10012997 | 3300010167 | Bacteria | 11894 |
| 87 | Ga0123353_12563249 | 3300010167 | Bacteria | 605 |
| 88 | Ga0415639_015732 | 3300038395 | Bacteria | 2635 |
| 89 | Ga0466691_171059 | 3300042593 | Bacteria | 7096 |
| 90 | JGI24698J34947_10001572 | 3300002449 | Bacteria | 12099 |
| 91 | JGI24698J34947_10015154 | 3300002449 | Bacteria | 4199 |
| 92 | JGI24698J34947_10037874 | 3300002449 | Bacteria | 2503 |
| 93 | Ga0072940_1016558 | 3300005200 | Bacteria | 2666 |
| 94 | Ga0072940_1017174 | 3300005200 | Bacteria | 10629 |
| 95 | Ga0072941_1006242 | 3300005201 | Bacteria | 23661 |
| 96 | Ga0466702_150386 | 3300042635 | Bacteria | 1579 |
| 97 | Ga0466702_321186 | 3300042635 | Unclassified | 1321 |
| 98 | Ga0466702_392009 | 3300042635 | Bacteria | 5687 |
| 99 | Ga0466718_020850 | 3300042617 | Bacteria | 2821 |
| 100 | Ga0466723_079805 | 3300042618 | Bacteria | 2072 |
| 101 | Ga0466700_250392 | 3300042600 | Bacteria | 1350 |
| 102 | Ga0123355_10699948 | 3300009826 | Bacteria | 1164 |
| 103 | Ga0123356_10205332 | 3300010049 | Bacteria | 2014 |
| 104 | Ga0123356_10515231 | 3300010049 | Bacteria | 1354 |
| 105 | Ga0123356_11075251 | 3300010049 | Bacteria | 973 |
| 106 | Ga0123356_12362908 | 3300010049 | Bacteria | 665 |
| 107 | Ga0264413_100374 | 3300024493 | Bacteria | 13930 |
| 108 | Ga0415639_001709 | 3300038395 | Bacteria | 19835 |
| 109 | Ga0415639_159753 | 3300038395 | Bacteria | 1780 |
| 110 | Ga0466691_130039 | 3300042593 | Bacteria | 1727 |
| 111 | Ga0466694_014010 | 3300042594 | Bacteria | 1634 |
| 112 | Ga0466699_362443 | 3300042597 | Bacteria | 2028 |
| 113 | 2230954254 | 2228664003 | Bacteria | 5327 |
| 114 | AustNasuHG_c1001592 | 3300000089 | Bacteria | 8190 |
| 115 | AustNasuHG_c1002307 | 3300000089 | Bacteria | 6887 |
| 116 | AustNasuHG_c1007977 | 3300000089 | Bacteria | 3752 |
| 117 | JGI24698J34947_10013528 | 3300002449 | Bacteria | 4453 |
| 118 | JGI24698J34947_10046415 | 3300002449 | Unclassified | 2210 |
| 119 | JGI24698J34947_10063033 | 3300002449 | Unclassified | 1818 |
| 120 | JGI24695J34938_10000926 | 3300002450 | Bacteria | 26844 |
| 121 | JGI24702J35022_10142289 | 3300002462 | Bacteria | 1339 |
| 122 | JGI24705J35276_12218808 | 3300002504 | Bacteria | 2167 |
| 123 | Ga0466702_365214 | 3300042635 | Bacteria | 1362 |
| 124 | Ga0466732_108264 | 3300042656 | Bacteria | 20151 |
| 125 | Ga0466712_105082 | 3300042614 | Bacteria | 28950 |
| 126 | Ga0466712_205092 | 3300042614 | Bacteria | 20979 |
| 127 | Ga0466711_348696 | 3300042615 | Bacteria | 1733 |
| 128 | Ga0466715_277056 | 3300042616 | Bacteria | 10263 |
| 129 | Ga0466726_259264 | 3300042619 | Archaea | 1445 |
| 130 | Ga0466700_258832 | 3300042600 | Bacteria | 1376 |
| 131 | Ga0466720_037410 | 3300042607 | Bacteria | 17150 |
| 132 | Ga0466721_141516 | 3300042608 | Bacteria | 1348 |
| 133 | Ga0466698_387288 | 3300042610 | Bacteria | 1847 |
| 134 | Ga0123355_11192317 | 3300009826 | Unclassified | 778 |
| 135 | Ga0123356_10000283 | 3300010049 | Bacteria | 58609 |
| 136 | Ga0123356_10037877 | 3300010049 | Bacteria | 4496 |
| 137 | Ga0123356_10060102 | 3300010049 | Unclassified | 3546 |
| 138 | Ga0123356_11017547 | 3300010049 | Bacteria | 998 |
| 139 | Ga0123353_10098100 | 3300010167 | Bacteria | 4723 |
| 140 | Ga0123353_11404129 | 3300010167 | Bacteria | 897 |
| 141 | Ga0123353_12121561 | 3300010167 | Bacteria | 683 |
| 142 | Ga0123354_10263431 | 3300010882 | Bacteria | 1715 |
| 143 | Ga0255786_1008692 | 3300022815 | Bacteria | 1306 |
| 144 | Ga0415639_006599 | 3300038395 | Bacteria | 20554 |
| 145 | Ga0466694_022614 | 3300042594 | Bacteria | 1626 |
| 146 | Ga0466699_298617 | 3300042597 | Bacteria | 2207 |
| 147 | Ga0466699_422071 | 3300042597 | Bacteria | 1381 |
| 148 | JGI24695J34938_10000551 | 3300002450 | Bacteria | 36191 |
| 149 | JGI24695J34938_10001017 | 3300002450 | Bacteria | 25353 |
| 150 | JGI24695J34938_10009917 | 3300002450 | Bacteria | 5260 |
| 151 | JGI24695J34938_10103502 | 3300002450 | Bacteria | 1162 |
| 152 | Ga0072940_1003312 | 3300005200 | Bacteria | 6938 |
| 153 | Ga0072941_1056240 | 3300005201 | Unclassified | 2136 |
| 154 | Ga0072941_1079049 | 3300005201 | Bacteria | 1603 |
| 155 | Ga0466702_128211 | 3300042635 | Bacteria | 1159 |
| 156 | Ga0466702_264936 | 3300042635 | Bacteria | 11019 |
| 157 | Ga0466712_051567 | 3300042614 | Bacteria | 5758 |
| 158 | Ga0466715_063212 | 3300042616 | Bacteria | 11433 |
| 159 | Ga0466715_278606 | 3300042616 | Bacteria | 18885 |
| 160 | Ga0466715_318882 | 3300042616 | Bacteria | 2832 |
| 161 | Ga0123356_10001758 | 3300010049 | Bacteria | 23601 |
| 162 | Ga0123356_10004752 | 3300010049 | Bacteria | 13982 |
| 163 | Ga0123356_10011554 | 3300010049 | Bacteria | 8602 |
| 164 | Ga0123356_10064118 | 3300010049 | Bacteria | 3434 |
| 165 | Ga0123353_10259911 | 3300010167 | Bacteria | 2683 |
| 166 | Ga0466693_078209 | 3300042592 | Bacteria | 15560 |
| 167 | Ga0466694_317970 | 3300042594 | Bacteria | 1192 |
| 168 | Ga0466699_208095 | 3300042597 | Bacteria | 4358 |
| 169 | JGI24698J34947_10001954 | 3300002449 | Bacteria | 10990 |
| 170 | Ga0072941_1081299 | 3300005201 | Bacteria | 945 |
| 171 | Ga0466731_218676 | 3300042622 | Bacteria | 2346 |
| 172 | Ga0466702_186654 | 3300042635 | Bacteria | 6018 |
| 173 | Ga0466727_126679 | 3300042655 | Bacteria | 1148 |
| 174 | Ga0466732_124786 | 3300042656 | Bacteria | 17148 |
| 175 | Ga0466712_088508 | 3300042614 | Bacteria | 18065 |
| 176 | Ga0466718_044533 | 3300042617 | Bacteria | 5353 |
| 177 | Ga0466718_058072 | 3300042617 | Bacteria | 9227 |
| 178 | Ga0466723_184735 | 3300042618 | Bacteria | 2908 |
| 179 | Ga0466720_002020 | 3300042607 | Bacteria | 40222 |
| 180 | Ga0466722_114793 | 3300042609 | Bacteria | 9485 |
| 181 | Ga0123356_11681260 | 3300010049 | Bacteria | 787 |
| 182 | Ga0123353_10293772 | 3300010167 | Bacteria | 2486 |
| 183 | Ga0123353_10680470 | 3300010167 | Bacteria | 1449 |
| 184 | Ga0123353_10880250 | 3300010167 | Bacteria | 1223 |
| 185 | Ga0123354_10245668 | 3300010882 | Bacteria | 1829 |
| 186 | Ga0415639_018379 | 3300038395 | Bacteria | 2437 |
| 187 | Ga0415639_060071 | 3300038395 | Bacteria | 3412 |
| 188 | Ga0466694_056550 | 3300042594 | Bacteria | 8920 |
| 189 | Ga0466694_086731 | 3300042594 | Bacteria | 3226 |
| 190 | Ga0466694_401115 | 3300042594 | Bacteria | 1378 |
| 191 | Ga0466699_058462 | 3300042597 | Bacteria | 5100 |
| 192 | AustNasuHG_c1015634 | 3300000089 | Bacteria | 2557 |
| 193 | JGI24698J34947_10002371 | 3300002449 | Bacteria | 10140 |
| 194 | JGI24695J34938_10000088 | 3300002450 | Bacteria | 80396 |
| 195 | JGI24695J34938_10005301 | 3300002450 | Bacteria | 8090 |
| 196 | JGI24702J35022_10002961 | 3300002462 | Bacteria | 10276 |
| 197 | JGI24702J35022_10068630 | 3300002462 | Bacteria | 1906 |
| 198 | Ga0123357_10003299 | 3300009784 | Bacteria | 18425 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.