Protein Family IF06797
Metagenome
Isolate
174
Members
58
Samples
163
Scaffolds
376.88
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_105067|Ga0466722_105067_1003_2376
- Length
- 457 aa
- Sequence
- MRFYQATHPRGMQAGIGKQHPYRQRRRDAQIGRFYNDPSYEHSLWDIRKNDYFMRLPCLIAGEQAQVQKKSLHLPLKNQFISMSVSVKEITTRKDLQKFVRFNIDLYKGNPYHVPGLIDEEIMTLSKDKNPAFEVCEAVYFLAFKDGRIVGRIAGIINHRSNDTWKQKYVRFGFVDFIDDCEVVDALFAAVEGWAKEKGMSAVHGPLGFTDLDHEGMLVEGFDLQGTMATIYNHPYYPEHLARIGYVKDQDWREFRIYVPAEVPEKHLRIGEMVKQKYGLEVIKFKRRKEIWPYAYKIFDALNKAYAPLYGFTELTPAQIRYYVKMYIPMLRLDFITVVRRKSDDAVAGFGITMPNLTRALRKARGSLFPFGFVPLLKALYGRPKVVDLYLIGVLPEYRNKGVNALMFNDLIPRYNKLGVEYAESNPELETNNAVQSQWDYFRREHHKTRRVFIKHI
Sample Types
Isolate
6.3%
Metagenome
93.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.9%
Kalotermitidae
24.1%
Unclassified
8.6%
Rhinotermitidae
8.6%
Blattidae
8.6%
Termopsidae
5.2%
Hydrophilidae
3.4%
Passalidae
3.4%
Taxonomy
Archaea
0
Bacteria
164
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 19 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 37 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 49 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 52 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 53 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 54 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 55 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466656_307241 | 3300042550 | Bacteria | 34645 |
| 2 | Ga0466693_069584 | 3300042592 | Bacteria | 1746 |
| 3 | Ga0466691_128711 | 3300042593 | Bacteria | 13062 |
| 4 | Ga0466696_079154 | 3300042596 | Bacteria | 7769 |
| 5 | Ga0466696_195108 | 3300042596 | Unclassified | 1757 |
| 6 | Ga0466719_272152 | 3300042606 | Bacteria | 10174 |
| 7 | Ga0123356_10029871 | 3300010049 | Bacteria | 5101 |
| 8 | Ga0068305_10107489 | 3300005083 | Bacteria | 6858 |
| 9 | Ga0068305_10182290 | 3300005083 | Bacteria | 3364 |
| 10 | Ga0123357_10003207 | 3300009784 | Bacteria | 18625 |
| 11 | Ga0466711_288486 | 3300042615 | Bacteria | 9707 |
| 12 | Ga0466711_431328 | 3300042615 | Bacteria | 2394 |
| 13 | Ga0466715_177524 | 3300042616 | Bacteria | 29754 |
| 14 | Ga0466715_384298 | 3300042616 | Bacteria | 5629 |
| 15 | Ga0466715_580385 | 3300042616 | Bacteria | 13241 |
| 16 | Ga0466723_055263 | 3300042618 | Bacteria | 32547 |
| 17 | Ga0466728_348809 | 3300042620 | Bacteria | 15447 |
| 18 | Ga0466704_517371 | 3300042643 | Bacteria | 8953 |
| 19 | Ga0466708_349638 | 3300042652 | Bacteria | 47516 |
| 20 | Ga0466725_165576 | 3300042654 | Bacteria | 35468 |
| 21 | Ga0466727_049687 | 3300042655 | Bacteria | 8087 |
| 22 | Ga0466727_073710 | 3300042655 | Bacteria | 9806 |
| 23 | Ga0466705_114303 | 3300042612 | Bacteria | 14740 |
| 24 | Ga0466690_005427 | 3300042590 | Bacteria | 12975 |
| 25 | Ga0466713_062679 | 3300042602 | Bacteria | 24995 |
| 26 | Ga0466719_016739 | 3300042606 | Bacteria | 6753 |
| 27 | Ga0466722_023960 | 3300042609 | Bacteria | 61916 |
| 28 | Ga0466722_175725 | 3300042609 | Bacteria | 3448 |
| 29 | Ga0123354_10028982 | 3300010882 | Bacteria | 8715 |
| 30 | 2227605181 | 2225789004 | Unclassified | 12278 |
| 31 | JGI24702J35022_10000057 | 3300002462 | Bacteria | 46789 |
| 32 | Ga0068302_10108545 | 3300005071 | Bacteria | 5634 |
| 33 | Ga0072940_1080325 | 3300005200 | Bacteria | 2344 |
| 34 | Ga0466711_191356 | 3300042615 | Bacteria | 27508 |
| 35 | Ga0466715_267820 | 3300042616 | Unclassified | 10097 |
| 36 | Ga0466726_077127 | 3300042619 | Bacteria | 5352 |
| 37 | Ga0466726_335343 | 3300042619 | Bacteria | 4819 |
| 38 | Ga0466703_280943 | 3300042636 | Bacteria | 23170 |
| 39 | Ga0466704_285232 | 3300042643 | Bacteria | 17633 |
| 40 | Ga0466709_279937 | 3300042648 | Bacteria | 21608 |
| 41 | Ga0466724_27387 | 3300042649 | Unclassified | 6448 |
| 42 | Ga0466705_035832 | 3300042612 | Bacteria | 29373 |
| 43 | Ga0466732_363920 | 3300042656 | Unclassified | 1672 |
| 44 | Ga0466657_347309 | 3300042582 | Bacteria | 1778 |
| 45 | Ga0466692_063390 | 3300042591 | Bacteria | 95171 |
| 46 | Ga0466692_097822 | 3300042591 | Bacteria | 1972 |
| 47 | Ga0466692_110987 | 3300042591 | Bacteria | 14998 |
| 48 | Ga0466691_044275 | 3300042593 | Bacteria | 2786 |
| 49 | Ga0466696_164301 | 3300042596 | Bacteria | 10142 |
| 50 | Ga0466713_060435 | 3300042602 | Bacteria | 2423 |
| 51 | Ga0466713_139979 | 3300042602 | Bacteria | 2304 |
| 52 | Ga0466716_420420 | 3300042605 | Bacteria | 4030 |
| 53 | Ga0466719_562029 | 3300042606 | Bacteria | 1929 |
| 54 | IMNBL1DRAFT_c0003735 | 3300000062 | Bacteria | 9544 |
| 55 | Ga0466712_128442 | 3300042614 | Unclassified | 1101 |
| 56 | Ga0466711_050929 | 3300042615 | Bacteria | 3729 |
| 57 | Ga0466703_224650 | 3300042636 | Bacteria | 19913 |
| 58 | Ga0466703_263656 | 3300042636 | Bacteria | 11570 |
| 59 | Ga0466704_054717 | 3300042643 | Bacteria | 5661 |
| 60 | Ga0466725_230878 | 3300042654 | Bacteria | 13850 |
| 61 | Ga0466727_115764 | 3300042655 | Bacteria | 5655 |
| 62 | Ga0466727_137933 | 3300042655 | Bacteria | 1505 |
| 63 | Ga0466697_186132 | 3300042611 | Bacteria | 64133 |
| 64 | Ga0466690_296178 | 3300042590 | Bacteria | 36079 |
| 65 | Ga0466691_071250 | 3300042593 | Bacteria | 14524 |
| 66 | Ga0466707_214392 | 3300042601 | Bacteria | 3488 |
| 67 | Ga0466713_041697 | 3300042602 | Bacteria | 3518 |
| 68 | Ga0466713_074435 | 3300042602 | Bacteria | 21266 |
| 69 | Ga0466713_105532 | 3300042602 | Bacteria | 9537 |
| 70 | Ga0466717_005462 | 3300042604 | Bacteria | 3740 |
| 71 | Ga0466719_056990 | 3300042606 | Bacteria | 5650 |
| 72 | Ga0466722_053445 | 3300042609 | Bacteria | 38463 |
| 73 | Ga0466722_105067 | 3300042609 | Bacteria | 2573 |
| 74 | 2227247461 | 2225789004 | Bacteria | 31587 |
| 75 | IMNBL1DRAFT_c0023804 | 3300000062 | Bacteria | 2391 |
| 76 | JGI24699J35502_11134029 | 3300002509 | Bacteria | 25256 |
| 77 | Ga0466705_457608 | 3300042612 | Bacteria | 5629 |
| 78 | Ga0466723_007065 | 3300042618 | Bacteria | 53793 |
| 79 | Ga0466703_279009 | 3300042636 | Bacteria | 7905 |
| 80 | Ga0466704_261973 | 3300042643 | Bacteria | 8154 |
| 81 | Ga0466704_576140 | 3300042643 | Bacteria | 20460 |
| 82 | Ga0466709_265222 | 3300042648 | Bacteria | 14675 |
| 83 | Ga0466705_110967 | 3300042612 | Bacteria | 24385 |
| 84 | Ga0466690_269144 | 3300042590 | Bacteria | 16302 |
| 85 | Ga0466696_123831 | 3300042596 | Bacteria | 10505 |
| 86 | Ga0466696_315891 | 3300042596 | Bacteria | 4040 |
| 87 | Ga0466707_060912 | 3300042601 | Bacteria | 42028 |
| 88 | Ga0466707_248901 | 3300042601 | Bacteria | 13572 |
| 89 | Ga0466716_099453 | 3300042605 | Bacteria | 3635 |
| 90 | Ga0466719_489521 | 3300042606 | Bacteria | 2347 |
| 91 | Ga0466698_370210 | 3300042610 | Bacteria | 1293 |
| 92 | Ga0123357_10007980 | 3300009784 | Bacteria | 13168 |
| 93 | IMNBL1DRAFT_c0020613 | 3300000062 | Bacteria | 2663 |
| 94 | JGI24702J35022_10000963 | 3300002462 | Bacteria | 17969 |
| 95 | JGI24702J35022_10001761 | 3300002462 | Bacteria | 13380 |
| 96 | JGI24702J35022_10017308 | 3300002462 | Bacteria | 3939 |
| 97 | Ga0068305_10020541 | 3300005083 | Unclassified | 10802 |
| 98 | Ga0466710_163410 | 3300042613 | Bacteria | 13309 |
| 99 | Ga0466711_060145 | 3300042615 | Bacteria | 25679 |
| 100 | Ga0466715_292663 | 3300042616 | Bacteria | 8507 |
| 101 | Ga0466715_618473 | 3300042616 | Unclassified | 2746 |
| 102 | Ga0466723_138227 | 3300042618 | Bacteria | 6433 |
| 103 | Ga0466726_332264 | 3300042619 | Bacteria | 8894 |
| 104 | Ga0466704_221110 | 3300042643 | Bacteria | 40792 |
| 105 | Ga0466704_355753 | 3300042643 | Bacteria | 30315 |
| 106 | Ga0466704_533747 | 3300042643 | Bacteria | 5146 |
| 107 | Ga0466709_411386 | 3300042648 | Bacteria | 55384 |
| 108 | Ga0466708_435918 | 3300042652 | Bacteria | 11349 |
| 109 | Ga0466727_031142 | 3300042655 | Bacteria | 12822 |
| 110 | Ga0466705_109256 | 3300042612 | Bacteria | 32157 |
| 111 | Ga0466690_167989 | 3300042590 | Bacteria | 19926 |
| 112 | Ga0466692_005818 | 3300042591 | Bacteria | 74984 |
| 113 | Ga0466691_205081 | 3300042593 | Bacteria | 7721 |
| 114 | Ga0466696_079042 | 3300042596 | Bacteria | 7348 |
| 115 | Ga0466707_026708 | 3300042601 | Bacteria | 11207 |
| 116 | Ga0466707_204652 | 3300042601 | Bacteria | 1608 |
| 117 | Ga0466713_031050 | 3300042602 | Unclassified | 2110 |
| 118 | Ga0466716_049153 | 3300042605 | Bacteria | 20638 |
| 119 | IMNBL1DRAFT_c0000112 | 3300000062 | Bacteria | 72967 |
| 120 | Ga0466710_260137 | 3300042613 | Bacteria | 3534 |
| 121 | Ga0466711_211822 | 3300042615 | Bacteria | 5519 |
| 122 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 123 | Ga0466729_014273 | 3300042621 | Bacteria | 6510 |
| 124 | Ga0466729_237192 | 3300042621 | Bacteria | 1466 |
| 125 | Ga0466708_135081 | 3300042652 | Bacteria | 7486 |
| 126 | Ga0466733_102098 | 3300042659 | Bacteria | 1948 |
| 127 | Ga0466690_095901 | 3300042590 | Bacteria | 22451 |
| 128 | Ga0466691_145457 | 3300042593 | Bacteria | 34874 |
| 129 | Ga0466696_175253 | 3300042596 | Bacteria | 14796 |
| 130 | Ga0466699_271742 | 3300042597 | Bacteria | 1527 |
| 131 | Ga0466713_017018 | 3300042602 | Bacteria | 51598 |
| 132 | Ga0466713_157157 | 3300042602 | Bacteria | 5985 |
| 133 | Ga0466716_432386 | 3300042605 | Bacteria | 11024 |
| 134 | Ga0466722_011222 | 3300042609 | Bacteria | 1536 |
| 135 | Ga0466722_213117 | 3300042609 | Bacteria | 4037 |
| 136 | 2227463519 | 2225789004 | Bacteria | 25632 |
| 137 | JGI24702J35022_10047481 | 3300002462 | Bacteria | 2285 |
| 138 | JGI24702J35022_10065367 | 3300002462 | Bacteria | 1951 |
| 139 | Ga0068302_10133969 | 3300005071 | Bacteria | 2921 |
| 140 | Ga0466715_311355 | 3300042616 | Bacteria | 3091 |
| 141 | Ga0466726_059499 | 3300042619 | Bacteria | 6756 |
| 142 | Ga0466728_024965 | 3300042620 | Bacteria | 19772 |
| 143 | Ga0466703_178920 | 3300042636 | Unclassified | 6461 |
| 144 | Ga0466703_318079 | 3300042636 | Bacteria | 11727 |
| 145 | Ga0466709_307822 | 3300042648 | Bacteria | 161839 |
| 146 | Ga0466705_111638 | 3300042612 | Bacteria | 8328 |
| 147 | Ga0466696_019948 | 3300042596 | Bacteria | 3800 |
| 148 | Ga0466696_307764 | 3300042596 | Bacteria | 13458 |
| 149 | Ga0466700_227790 | 3300042600 | Bacteria | 3734 |
| 150 | Ga0466707_246704 | 3300042601 | Bacteria | 5392 |
| 151 | Ga0466713_038630 | 3300042602 | Bacteria | 81183 |
| 152 | Ga0466717_019943 | 3300042604 | Bacteria | 1758 |
| 153 | Ga0466719_019138 | 3300042606 | Bacteria | 17343 |
| 154 | Ga0466722_010442 | 3300042609 | Bacteria | 16245 |
| 155 | Ga0123353_10304267 | 3300010167 | Bacteria | 2431 |
| 156 | 2227604902 | 2225789004 | Bacteria | 2305 |
| 157 | JGI24705J35276_12238737 | 3300002504 | Bacteria | 48270 |
| 158 | Ga0466711_467682 | 3300042615 | Bacteria | 24337 |
| 159 | Ga0466711_478258 | 3300042615 | Bacteria | 5361 |
| 160 | Ga0466715_074491 | 3300042616 | Bacteria | 5487 |
| 161 | Ga0466715_364671 | 3300042616 | Bacteria | 20378 |
| 162 | Ga0466704_124246 | 3300042643 | Bacteria | 3265 |
| 163 | Ga0466704_224224 | 3300042643 | Bacteria | 2631 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.