Protein Family IF06781
Metagenome
Isolate
193
Members
52
Samples
187
Scaffolds
165.09
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_083098|Ga0466722_083098_169_753
- Length
- 194 aa
- Sequence
- VAAKIHNLNRLLWFFNPHFPKVYHTGDKENRMPENEYRRPSWDEYFMEVCDAIAKRATCDRGRSGCVIAKDNQLLVTGYVGAPAGLPHCDEVGHQFKQMLHEDGSVTTHCVRTVHAEQNAICQAAKRGIPISGATLYCRMTPCRTCAMLIINCGIVRVVCQRRYHDGGDSEAMFAKAGITLEYVHDEVQQYEKQ
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Kalotermitidae
28.0%
Unclassified
16.0%
Rhinotermitidae
8.0%
Termopsidae
6.0%
Passalidae
2.0%
Taxonomy
Archaea
3
Bacteria
170
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 26 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 27 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_006561 | 3300042656 | Bacteria | 4233 |
| 2 | Ga0466732_222355 | 3300042656 | Bacteria | 1560 |
| 3 | Ga0456237_0000064 | 3300041968 | Bacteria | 14969 |
| 4 | Ga0466692_100514 | 3300042591 | Bacteria | 8345 |
| 5 | Ga0466691_082659 | 3300042593 | Bacteria | 3771 |
| 6 | Ga0466696_017564 | 3300042596 | Bacteria | 33026 |
| 7 | Ga0466699_365611 | 3300042597 | Bacteria | 7639 |
| 8 | Ga0123356_11110676 | 3300010049 | Bacteria | 959 |
| 9 | JGI24698J34947_10024096 | 3300002449 | Bacteria | 3251 |
| 10 | JGI24695J34938_10007039 | 3300002450 | Bacteria | 6657 |
| 11 | Ga0466712_277462 | 3300042614 | Bacteria | 1233 |
| 12 | Ga0466728_039789 | 3300042620 | Bacteria | 2151 |
| 13 | Ga0466700_037696 | 3300042600 | Bacteria | 1239 |
| 14 | Ga0466707_324814 | 3300042601 | Bacteria | 1118 |
| 15 | Ga0466720_083817 | 3300042607 | Bacteria | 14286 |
| 16 | Ga0466722_165194 | 3300042609 | Bacteria | 4666 |
| 17 | Ga0466722_239362 | 3300042609 | Bacteria | 27768 |
| 18 | Ga0466698_249615 | 3300042610 | Bacteria | 1080 |
| 19 | Ga0466705_103001 | 3300042612 | Unclassified | 4360 |
| 20 | Ga0466729_234972 | 3300042621 | Unclassified | 1199 |
| 21 | Ga0466709_284196 | 3300042648 | Bacteria | 18825 |
| 22 | Ga0466699_059640 | 3300042597 | Bacteria | 47744 |
| 23 | Ga0466699_221331 | 3300042597 | Bacteria | 8319 |
| 24 | Ga0123356_11811501 | 3300010049 | Archaea | 759 |
| 25 | Ga0123353_10914217 | 3300010167 | Unclassified | 1193 |
| 26 | Ga0466712_022070 | 3300042614 | Bacteria | 1324 |
| 27 | Ga0466712_042197 | 3300042614 | Bacteria | 13711 |
| 28 | Ga0466711_167283 | 3300042615 | Bacteria | 2672 |
| 29 | Ga0466715_169524 | 3300042616 | Bacteria | 17527 |
| 30 | Ga0466726_330184 | 3300042619 | Bacteria | 6856 |
| 31 | Ga0466707_203556 | 3300042601 | Bacteria | 1947 |
| 32 | Ga0466720_026808 | 3300042607 | Bacteria | 11297 |
| 33 | Ga0466720_202653 | 3300042607 | Bacteria | 24999 |
| 34 | Ga0466722_004820 | 3300042609 | Bacteria | 1452 |
| 35 | Ga0466722_083098 | 3300042609 | Bacteria | 8261 |
| 36 | Ga0466722_156117 | 3300042609 | Bacteria | 4351 |
| 37 | Ga0466722_253615 | 3300042609 | Bacteria | 3901 |
| 38 | Ga0466731_099359 | 3300042622 | Bacteria | 4462 |
| 39 | Ga0466704_042739 | 3300042643 | Bacteria | 2611 |
| 40 | Ga0466727_215907 | 3300042655 | Bacteria | 1440 |
| 41 | Ga0415639_165780 | 3300038395 | Bacteria | 1332 |
| 42 | Ga0466690_141462 | 3300042590 | Bacteria | 1489 |
| 43 | Ga0466696_016014 | 3300042596 | Bacteria | 6118 |
| 44 | Ga0466696_151342 | 3300042596 | Bacteria | 10046 |
| 45 | Ga0123353_11481086 | 3300010167 | Bacteria | 866 |
| 46 | Ga0123354_10128938 | 3300010882 | Unclassified | 3209 |
| 47 | JGI24698J34947_10020173 | 3300002449 | Bacteria | 3594 |
| 48 | JGI24702J35022_10002938 | 3300002462 | Bacteria | 10312 |
| 49 | Ga0068305_10000903 | 3300005083 | Bacteria | 10167 |
| 50 | Ga0466712_052059 | 3300042614 | Bacteria | 79687 |
| 51 | Ga0466712_156968 | 3300042614 | Bacteria | 2123 |
| 52 | Ga0466723_259470 | 3300042618 | Bacteria | 15035 |
| 53 | Ga0466716_146455 | 3300042605 | Bacteria | 21520 |
| 54 | Ga0466719_142623 | 3300042606 | Bacteria | 7941 |
| 55 | Ga0466720_081012 | 3300042607 | Bacteria | 5344 |
| 56 | Ga0466720_141815 | 3300042607 | Bacteria | 13412 |
| 57 | Ga0466720_147532 | 3300042607 | Bacteria | 19881 |
| 58 | Ga0466705_063692 | 3300042612 | Bacteria | 1309 |
| 59 | Ga0466703_142193 | 3300042636 | Bacteria | 17251 |
| 60 | Ga0466708_125344 | 3300042652 | Bacteria | 26258 |
| 61 | Ga0466727_148665 | 3300042655 | Bacteria | 1294 |
| 62 | Ga0466727_219094 | 3300042655 | Bacteria | 10010 |
| 63 | Ga0466732_268328 | 3300042656 | Bacteria | 1753 |
| 64 | Ga0466690_121299 | 3300042590 | Unclassified | 3539 |
| 65 | Ga0466692_070133 | 3300042591 | Bacteria | 1002 |
| 66 | Ga0466691_016993 | 3300042593 | Bacteria | 7784 |
| 67 | Ga0466691_054711 | 3300042593 | Bacteria | 1896 |
| 68 | Ga0123353_10103331 | 3300010167 | Bacteria | 4593 |
| 69 | Ga0123353_10440501 | 3300010167 | Bacteria | 1922 |
| 70 | Ga0123353_10534079 | 3300010167 | Bacteria | 1697 |
| 71 | Ga0123353_11285607 | 3300010167 | Unclassified | 951 |
| 72 | Ga0123354_10436084 | 3300010882 | Bacteria | 1074 |
| 73 | JGI24698J34947_10132956 | 3300002449 | Bacteria | 1060 |
| 74 | Ga0072940_1109438 | 3300005200 | Bacteria | 799 |
| 75 | Ga0466718_016493 | 3300042617 | Bacteria | 2009 |
| 76 | Ga0466718_020186 | 3300042617 | Bacteria | 16920 |
| 77 | Ga0466723_109320 | 3300042618 | Bacteria | 10178 |
| 78 | Ga0466700_115112 | 3300042600 | Archaea | 1383 |
| 79 | Ga0466700_277318 | 3300042600 | Bacteria | 1001 |
| 80 | Ga0466722_238629 | 3300042609 | Bacteria | 12982 |
| 81 | Ga0466722_239790 | 3300042609 | Unclassified | 2052 |
| 82 | Ga0466698_394443 | 3300042610 | Bacteria | 1069 |
| 83 | Ga0466698_486317 | 3300042610 | Bacteria | 2180 |
| 84 | Ga0466705_328583 | 3300042612 | Bacteria | 7781 |
| 85 | Ga0466731_339199 | 3300042622 | Bacteria | 43843 |
| 86 | Ga0466735_203429 | 3300042624 | Bacteria | 1192 |
| 87 | Ga0466703_077197 | 3300042636 | Bacteria | 16924 |
| 88 | Ga0466704_265126 | 3300042643 | Unclassified | 1989 |
| 89 | Ga0466692_203632 | 3300042591 | Bacteria | 17371 |
| 90 | Ga0466699_018132 | 3300042597 | Bacteria | 1534 |
| 91 | Ga0466699_423996 | 3300042597 | Bacteria | 15119 |
| 92 | Ga0123357_10652434 | 3300009784 | Bacteria | 778 |
| 93 | Ga0123353_10641196 | 3300010167 | Bacteria | 1506 |
| 94 | Ga0123354_10360357 | 3300010882 | Bacteria | 1283 |
| 95 | AustNasuHG_c1023032 | 3300000089 | Unclassified | 1994 |
| 96 | JGI24698J34947_10004600 | 3300002449 | Bacteria | 7518 |
| 97 | JGI24695J34938_10054045 | 3300002450 | Bacteria | 1743 |
| 98 | Ga0466712_041274 | 3300042614 | Bacteria | 5081 |
| 99 | Ga0466712_111132 | 3300042614 | Bacteria | 1129 |
| 100 | Ga0466712_186337 | 3300042614 | Unclassified | 11346 |
| 101 | Ga0466711_023601 | 3300042615 | Unclassified | 5747 |
| 102 | Ga0466718_016393 | 3300042617 | Bacteria | 23217 |
| 103 | Ga0466726_221588 | 3300042619 | Bacteria | 2399 |
| 104 | Ga0466726_341516 | 3300042619 | Bacteria | 1510 |
| 105 | Ga0466700_184053 | 3300042600 | Bacteria | 1767 |
| 106 | Ga0466707_000664 | 3300042601 | Bacteria | 1325 |
| 107 | Ga0466708_406541 | 3300042652 | Bacteria | 2090 |
| 108 | Ga0466692_022972 | 3300042591 | Bacteria | 5600 |
| 109 | Ga0466691_133776 | 3300042593 | Bacteria | 5748 |
| 110 | Ga0466694_007564 | 3300042594 | Bacteria | 6517 |
| 111 | Ga0466694_230170 | 3300042594 | Bacteria | 1161 |
| 112 | Ga0466699_440570 | 3300042597 | Bacteria | 19120 |
| 113 | Ga0123357_10303706 | 3300009784 | Bacteria | 1607 |
| 114 | Ga0123357_10357952 | 3300009784 | Bacteria | 1386 |
| 115 | Ga0123357_10599863 | 3300009784 | Bacteria | 846 |
| 116 | Ga0123356_12877002 | 3300010049 | Bacteria | 602 |
| 117 | Ga0123353_10338241 | 3300010167 | Bacteria | 2275 |
| 118 | Ga0123353_10354288 | 3300010167 | Archaea | 2209 |
| 119 | Ga0123353_10607415 | 3300010167 | Bacteria | 1561 |
| 120 | Ga0123353_11046190 | 3300010167 | Bacteria | 1091 |
| 121 | Ga0123353_12262593 | 3300010167 | Bacteria | 655 |
| 122 | 2227129975 | 2225789004 | Bacteria | 1665 |
| 123 | JGI24698J34947_10001919 | 3300002449 | Bacteria | 11075 |
| 124 | JGI24698J34947_10008308 | 3300002449 | Bacteria | 5692 |
| 125 | JGI24698J34947_10010628 | 3300002449 | Bacteria | 5052 |
| 126 | JGI24698J34947_10038553 | 3300002449 | Unclassified | 2478 |
| 127 | JGI24698J34947_10061609 | 3300002449 | Bacteria | 1845 |
| 128 | JGI24702J35022_10016609 | 3300002462 | Bacteria | 4032 |
| 129 | Ga0068305_10018320 | 3300005083 | Bacteria | 7909 |
| 130 | Ga0466712_087749 | 3300042614 | Bacteria | 43183 |
| 131 | Ga0466712_089437 | 3300042614 | Unclassified | 11316 |
| 132 | Ga0466711_011675 | 3300042615 | Bacteria | 3857 |
| 133 | Ga0466715_042867 | 3300042616 | Bacteria | 2599 |
| 134 | Ga0466718_062922 | 3300042617 | Bacteria | 20441 |
| 135 | Ga0466716_130660 | 3300042605 | Bacteria | 4419 |
| 136 | Ga0466719_170837 | 3300042606 | Bacteria | 3651 |
| 137 | Ga0466719_359578 | 3300042606 | Bacteria | 9005 |
| 138 | Ga0466722_086687 | 3300042609 | Bacteria | 5876 |
| 139 | Ga0466735_033991 | 3300042624 | Bacteria | 16705 |
| 140 | Ga0466735_167944 | 3300042624 | Bacteria | 8234 |
| 141 | Ga0466704_264522 | 3300042643 | Bacteria | 19667 |
| 142 | Ga0466704_460367 | 3300042643 | Bacteria | 6733 |
| 143 | Ga0466708_023711 | 3300042652 | Bacteria | 8023 |
| 144 | Ga0466708_165474 | 3300042652 | Bacteria | 34114 |
| 145 | Ga0466708_275739 | 3300042652 | Bacteria | 2948 |
| 146 | Ga0466727_072749 | 3300042655 | Bacteria | 5645 |
| 147 | Ga0264413_130652 | 3300024493 | Bacteria | 5547 |
| 148 | Ga0466692_042303 | 3300042591 | Bacteria | 7582 |
| 149 | Ga0466694_029990 | 3300042594 | Bacteria | 16898 |
| 150 | Ga0466694_190579 | 3300042594 | Bacteria | 1229 |
| 151 | Ga0466696_386203 | 3300042596 | Unclassified | 1236 |
| 152 | Ga0123357_10377451 | 3300009784 | Bacteria | 1320 |
| 153 | Ga0123355_10299906 | 3300009826 | Bacteria | 2192 |
| 154 | Ga0123356_10584141 | 3300010049 | Bacteria | 1281 |
| 155 | Ga0123353_10817789 | 3300010167 | Bacteria | 1283 |
| 156 | AustNasuHG_c1025723 | 3300000089 | Bacteria | 1845 |
| 157 | Ga0466712_278440 | 3300042614 | Bacteria | 1310 |
| 158 | Ga0466718_046928 | 3300042617 | Bacteria | 4344 |
| 159 | Ga0466723_031125 | 3300042618 | Bacteria | 2936 |
| 160 | Ga0466720_041045 | 3300042607 | Bacteria | 14375 |
| 161 | Ga0466704_340969 | 3300042643 | Unclassified | 1888 |
| 162 | Ga0466704_506123 | 3300042643 | Bacteria | 10442 |
| 163 | Ga0466732_164966 | 3300042656 | Bacteria | 8192 |
| 164 | Ga0456237_0007483 | 3300041968 | Bacteria | 1679 |
| 165 | Ga0456237_0019477 | 3300041968 | Bacteria | 944 |
| 166 | Ga0466690_098801 | 3300042590 | Bacteria | 8571 |
| 167 | Ga0466692_077714 | 3300042591 | Bacteria | 2820 |
| 168 | Ga0466692_092196 | 3300042591 | Bacteria | 1507 |
| 169 | Ga0466696_418181 | 3300042596 | Bacteria | 6301 |
| 170 | Ga0123354_10678108 | 3300010882 | Bacteria | 727 |
| 171 | JGI24698J34947_10026068 | 3300002449 | Unclassified | 3109 |
| 172 | JGI24698J34947_10058259 | 3300002449 | Bacteria | 1914 |
| 173 | JGI24698J34947_10081406 | 3300002449 | Bacteria | 1518 |
| 174 | Ga0068305_10050686 | 3300005083 | Bacteria | 2987 |
| 175 | Ga0072941_1044035 | 3300005201 | Bacteria | 4760 |
| 176 | Ga0466712_037815 | 3300042614 | Unclassified | 10024 |
| 177 | Ga0466712_049609 | 3300042614 | Bacteria | 3196 |
| 178 | Ga0466712_066790 | 3300042614 | Bacteria | 31024 |
| 179 | Ga0466712_199670 | 3300042614 | Unclassified | 2192 |
| 180 | Ga0466712_221090 | 3300042614 | Bacteria | 8046 |
| 181 | Ga0466711_338036 | 3300042615 | Bacteria | 2189 |
| 182 | Ga0466711_442880 | 3300042615 | Unclassified | 2195 |
| 183 | Ga0466726_335318 | 3300042619 | Bacteria | 1228 |
| 184 | Ga0466726_497104 | 3300042619 | Bacteria | 2579 |
| 185 | Ga0466720_100776 | 3300042607 | Bacteria | 35029 |
| 186 | Ga0466720_150429 | 3300042607 | Unclassified | 9062 |
| 187 | Ga0466727_182399 | 3300042655 | Bacteria | 1331 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.