Protein Family IF06749
Metagenome
Metatranscriptome
Isolate
162
Members
47
Samples
157
Scaffolds
284.6
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_048903|Ga0466722_048903_1062_2126
- Length
- 336 aa
- Sequence
- MSVKQKVVFADIGGMSSILGFVFRRQVRIFCGVAFVLVFTAQSFAESREHTVQSGETAYTLARRYGVRPEEILFINGIEDARKIKVGQKLRIPEGNTMARPALDNGVEPPPVIVAHTAVNGDTLYGIARKYGITYQALVDANNFSKDKKLKIGERVNVPVPASVPANSGSAEAVPALAAAGNESGLPVNKMAAPIGKQQVQAPIKTGVAAKPAGRQVDLKLKWPVRIKDAAYMTGKLDGVVLTGEKAASVQSLSAGTVASAGPYRGFGRVAIVQSDSGYIYVYGGCETLSVRAGERIAAGSEIGRLGVDAVSQKPQLFFMVYNGTKAIDPAKAPRA
Sample Types
Isolate
3.1%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.5%
Kalotermitidae
30.4%
Unclassified
13.0%
Termopsidae
6.5%
Rhinotermitidae
4.3%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 29 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 46 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_295321 | 3300042612 | Bacteria | 8627 |
| 2 | Ga0466732_034414 | 3300042656 | Bacteria | 5941 |
| 3 | Ga0466692_149841 | 3300042591 | Bacteria | 1987 |
| 4 | Ga0466692_179439 | 3300042591 | Bacteria | 1554 |
| 5 | Ga0466695_126976 | 3300042595 | Bacteria | 4567 |
| 6 | Ga0466722_184247 | 3300042609 | Bacteria | 2940 |
| 7 | Ga0466722_193529 | 3300042609 | Bacteria | 30621 |
| 8 | JGI24695J34938_10003194 | 3300002450 | Bacteria | 11619 |
| 9 | Ga0072940_1009028 | 3300005200 | Bacteria | 5628 |
| 10 | Ga0466702_075005 | 3300042635 | Bacteria | 1742 |
| 11 | Ga0466704_189303 | 3300042643 | Bacteria | 9296 |
| 12 | Ga0466708_266872 | 3300042652 | Bacteria | 3617 |
| 13 | Ga0466718_121137 | 3300042617 | Bacteria | 3713 |
| 14 | Ga0466728_177495 | 3300042620 | Bacteria | 1739 |
| 15 | Ga0466705_011940 | 3300042612 | Bacteria | 3059 |
| 16 | Ga0466732_202370 | 3300042656 | Bacteria | 3146 |
| 17 | Ga0466690_299911 | 3300042590 | Bacteria | 2769 |
| 18 | Ga0466692_180380 | 3300042591 | Bacteria | 3156 |
| 19 | Ga0466693_028489 | 3300042592 | Bacteria | 28385 |
| 20 | Ga0466716_297880 | 3300042605 | Bacteria | 2267 |
| 21 | Ga0466720_096016 | 3300042607 | Bacteria | 7198 |
| 22 | Ga0466722_048903 | 3300042609 | Bacteria | 2612 |
| 23 | Ga0123356_10051886 | 3300010049 | Bacteria | 3815 |
| 24 | Ga0123353_10200476 | 3300010167 | Bacteria | 3140 |
| 25 | Ga0466703_153800 | 3300042636 | Bacteria | 17216 |
| 26 | Ga0466703_263014 | 3300042636 | Bacteria | 15134 |
| 27 | Ga0466709_080691 | 3300042648 | Bacteria | 9995 |
| 28 | Ga0466718_030652 | 3300042617 | Bacteria | 8310 |
| 29 | Ga0466728_217926 | 3300042620 | Bacteria | 7283 |
| 30 | Ga0466692_066107 | 3300042591 | Bacteria | 9614 |
| 31 | Ga0466692_102496 | 3300042591 | Bacteria | 6892 |
| 32 | Ga0466692_120882 | 3300042591 | Bacteria | 3840 |
| 33 | Ga0466691_148977 | 3300042593 | Bacteria | 2542 |
| 34 | Ga0466695_161607 | 3300042595 | Bacteria | 1373 |
| 35 | Ga0466696_294679 | 3300042596 | Bacteria | 4328 |
| 36 | Ga0466696_363841 | 3300042596 | Bacteria | 2234 |
| 37 | Ga0466706_241686 | 3300042599 | Bacteria | 1104 |
| 38 | Ga0466719_100135 | 3300042606 | Bacteria | 2032 |
| 39 | Ga0466719_107013 | 3300042606 | Bacteria | 7234 |
| 40 | Ga0466719_124329 | 3300042606 | Bacteria | 3742 |
| 41 | Ga0466722_097331 | 3300042609 | Bacteria | 79624 |
| 42 | JGI24698J34947_10012326 | 3300002449 | Bacteria | 4686 |
| 43 | Ga0123353_10128920 | 3300010167 | Bacteria | 4062 |
| 44 | Ga0466702_200538 | 3300042635 | Bacteria | 14051 |
| 45 | Ga0466708_217800 | 3300042652 | Bacteria | 27433 |
| 46 | Ga0466727_311482 | 3300042655 | Bacteria | 2875 |
| 47 | Ga0466712_047845 | 3300042614 | Bacteria | 13706 |
| 48 | Ga0466715_000668 | 3300042616 | Bacteria | 11725 |
| 49 | Ga0466715_200488 | 3300042616 | Bacteria | 3209 |
| 50 | Ga0466718_027146 | 3300042617 | Bacteria | 1149 |
| 51 | Ga0466723_365116 | 3300042618 | Bacteria | 3858 |
| 52 | Ga0466728_163226 | 3300042620 | Bacteria | 3801 |
| 53 | Ga0255786_1024856 | 3300022815 | Bacteria | 1331 |
| 54 | Ga0466690_032423 | 3300042590 | Bacteria | 5059 |
| 55 | Ga0466692_054086 | 3300042591 | Bacteria | 5153 |
| 56 | Ga0466692_067977 | 3300042591 | Bacteria | 15699 |
| 57 | Ga0466691_072650 | 3300042593 | Bacteria | 4725 |
| 58 | Ga0466699_370677 | 3300042597 | Bacteria | 6829 |
| 59 | Ga0466719_418728 | 3300042606 | Bacteria | 36150 |
| 60 | Ga0466720_068889 | 3300042607 | Bacteria | 7067 |
| 61 | Ga0072941_1329632 | 3300005201 | Bacteria | 1387 |
| 62 | Ga0123357_10184455 | 3300009784 | Bacteria | 2425 |
| 63 | Ga0123356_10608097 | 3300010049 | Bacteria | 1258 |
| 64 | Ga0123353_10480481 | 3300010167 | Bacteria | 1818 |
| 65 | Ga0123354_10175337 | 3300010882 | Bacteria | 2474 |
| 66 | Ga0466703_370311 | 3300042636 | Bacteria | 15744 |
| 67 | Ga0466709_015042 | 3300042648 | Bacteria | 1545 |
| 68 | Ga0466708_002059 | 3300042652 | Bacteria | 10518 |
| 69 | Ga0466711_173907 | 3300042615 | Bacteria | 1628 |
| 70 | Ga0466715_592267 | 3300042616 | Bacteria | 17861 |
| 71 | Ga0466718_150093 | 3300042617 | Bacteria | 1153 |
| 72 | Ga0466723_141476 | 3300042618 | Bacteria | 6613 |
| 73 | Ga0466723_190538 | 3300042618 | Bacteria | 9581 |
| 74 | Ga0466723_374405 | 3300042618 | Bacteria | 1535 |
| 75 | Ga0466728_464994 | 3300042620 | Bacteria | 14752 |
| 76 | Ga0466732_075598 | 3300042656 | Bacteria | 4579 |
| 77 | Ga0415639_063056 | 3300038395 | Bacteria | 1143 |
| 78 | Ga0415639_137242 | 3300038395 | Bacteria | 1481 |
| 79 | Ga0466691_066487 | 3300042593 | Bacteria | 11965 |
| 80 | Ga0466707_319525 | 3300042601 | Bacteria | 10271 |
| 81 | Ga0466719_334832 | 3300042606 | Bacteria | 5109 |
| 82 | Ga0466722_191015 | 3300042609 | Bacteria | 2950 |
| 83 | Ga0466722_198434 | 3300042609 | Bacteria | 2904 |
| 84 | Ga0072941_1089056 | 3300005201 | Bacteria | 1575 |
| 85 | Ga0466709_237573 | 3300042648 | Bacteria | 17749 |
| 86 | Ga0466711_317791 | 3300042615 | Bacteria | 2564 |
| 87 | Ga0466715_005024 | 3300042616 | Bacteria | 8146 |
| 88 | Ga0466715_026977 | 3300042616 | Bacteria | 8369 |
| 89 | Ga0466723_122593 | 3300042618 | Bacteria | 7404 |
| 90 | Ga0466726_287810 | 3300042619 | Bacteria | 2010 |
| 91 | Ga0466705_017705 | 3300042612 | Bacteria | 12912 |
| 92 | Ga0466692_061336 | 3300042591 | Bacteria | 1295 |
| 93 | Ga0466706_104935 | 3300042599 | Bacteria | 2120 |
| 94 | Ga0466722_127138 | 3300042609 | Bacteria | 4358 |
| 95 | Ga0466722_251605 | 3300042609 | Bacteria | 2665 |
| 96 | Ga0072940_1040999 | 3300005200 | Bacteria | 1748 |
| 97 | Ga0072941_1022880 | 3300005201 | Bacteria | 13997 |
| 98 | Ga0123357_10083568 | 3300009784 | Bacteria | 4190 |
| 99 | Ga0123356_10058440 | 3300010049 | Bacteria | 3596 |
| 100 | Ga0466735_196552 | 3300042624 | Bacteria | 20904 |
| 101 | Ga0466709_058843 | 3300042648 | Bacteria | 3656 |
| 102 | Ga0466709_334453 | 3300042648 | Bacteria | 2610 |
| 103 | Ga0466708_092476 | 3300042652 | Bacteria | 25952 |
| 104 | Ga0466708_412239 | 3300042652 | Bacteria | 12537 |
| 105 | Ga0466712_040280 | 3300042614 | Bacteria | 9433 |
| 106 | Ga0466712_181889 | 3300042614 | Bacteria | 2469 |
| 107 | Ga0466715_327224 | 3300042616 | Bacteria | 1749 |
| 108 | Ga0466715_471919 | 3300042616 | Bacteria | 1308 |
| 109 | Ga0466718_014320 | 3300042617 | Bacteria | 3875 |
| 110 | Ga0466718_015756 | 3300042617 | Bacteria | 1646 |
| 111 | Ga0466718_066130 | 3300042617 | Bacteria | 1608 |
| 112 | Ga0466723_254144 | 3300042618 | Bacteria | 1895 |
| 113 | Ga0466723_280654 | 3300042618 | Bacteria | 24305 |
| 114 | Ga0466726_174213 | 3300042619 | Unclassified | 28101 |
| 115 | Ga0466728_204789 | 3300042620 | Bacteria | 4277 |
| 116 | Ga0466692_093846 | 3300042591 | Bacteria | 17043 |
| 117 | Ga0466696_044431 | 3300042596 | Bacteria | 2298 |
| 118 | Ga0466699_024094 | 3300042597 | Bacteria | 2733 |
| 119 | Ga0466719_093752 | 3300042606 | Bacteria | 6910 |
| 120 | AustNasuHG_c1018515 | 3300000089 | Bacteria | 2297 |
| 121 | JGI24702J35022_10001234 | 3300002462 | Bacteria | 15932 |
| 122 | JGI24702J35022_10039965 | 3300002462 | Bacteria | 2502 |
| 123 | Ga0123356_10004605 | 3300010049 | Bacteria | 14210 |
| 124 | Ga0123353_10210911 | 3300010167 | Bacteria | 3046 |
| 125 | Ga0466702_402423 | 3300042635 | Bacteria | 2133 |
| 126 | Ga0466703_189991 | 3300042636 | Bacteria | 8633 |
| 127 | Ga0466704_244203 | 3300042643 | Bacteria | 8975 |
| 128 | Ga0466708_040910 | 3300042652 | Unclassified | 3399 |
| 129 | Ga0466708_135875 | 3300042652 | Bacteria | 4426 |
| 130 | Ga0466708_198639 | 3300042652 | Bacteria | 9642 |
| 131 | Ga0466708_341935 | 3300042652 | Bacteria | 2117 |
| 132 | Ga0466727_210070 | 3300042655 | Bacteria | 3493 |
| 133 | Ga0466715_005887 | 3300042616 | Bacteria | 3289 |
| 134 | Ga0466723_097146 | 3300042618 | Bacteria | 9188 |
| 135 | Ga0466723_102621 | 3300042618 | Bacteria | 3651 |
| 136 | Ga0466705_156874 | 3300042612 | Bacteria | 9841 |
| 137 | Ga0466690_002788 | 3300042590 | Bacteria | 26421 |
| 138 | Ga0466694_188429 | 3300042594 | Bacteria | 57168 |
| 139 | Ga0466696_054348 | 3300042596 | Bacteria | 3074 |
| 140 | Ga0466707_363361 | 3300042601 | Bacteria | 1324 |
| 141 | Ga0466722_223972 | 3300042609 | Bacteria | 1444 |
| 142 | JGI24702J35022_10001511 | 3300002462 | Bacteria | 14441 |
| 143 | Ga0466704_141059 | 3300042643 | Bacteria | 4105 |
| 144 | Ga0466704_264522 | 3300042643 | Bacteria | 19667 |
| 145 | Ga0466708_004910 | 3300042652 | Bacteria | 5911 |
| 146 | Ga0466708_312416 | 3300042652 | Bacteria | 85118 |
| 147 | Ga0466727_129467 | 3300042655 | Bacteria | 1942 |
| 148 | Ga0466711_025285 | 3300042615 | Bacteria | 3769 |
| 149 | Ga0466715_017184 | 3300042616 | Bacteria | 2806 |
| 150 | Ga0466718_043350 | 3300042617 | Bacteria | 1264 |
| 151 | Ga0466718_049284 | 3300042617 | Bacteria | 5267 |
| 152 | Ga0466718_064276 | 3300042617 | Bacteria | 3470 |
| 153 | Ga0466718_087399 | 3300042617 | Bacteria | 20374 |
| 154 | Ga0466718_142235 | 3300042617 | Bacteria | 1790 |
| 155 | Ga0466726_348171 | 3300042619 | Bacteria | 5987 |
| 156 | Ga0466728_103149 | 3300042620 | Bacteria | 8224 |
| 157 | Ga0466728_235590 | 3300042620 | Bacteria | 3995 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.