Protein Family IF06661
Metagenome
Isolate
181
Members
60
Samples
167
Scaffolds
341.27
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_115891|Ga0466720_115891_117_1370
- Length
- 400 aa
- Sequence
- LTRGNGCVYPQLFSTIYKLTQYGGRDNTLFLAHSLFFCYFLDMEKFADEAIIEVSSGSGGNGCVAFRREKYIPLGGPSGGXXGRGGDVVFTVRRNVRTLAHLRYKHTFKAKNGQDGRGSGCYGKNGEDIVIPLPPGSIVREAETGELVKDFSEEARDKDDFVFLKGGNGGWGNIHFKSSVNQAPRKALPGQPGQTVQLKIELHIMADIGLVGFPNAGKSSLLDRFTNARPKIAAYPFTTKIPNLGVLTVGDSNDTGGRDVIIADIPGLIEGASQGAGLGIRFLKHISRTSALAFLIDLSDANYLSAFDVLQQELASFSPELVQKKRLLVGTKTDLPETEGRLAELAAKYPNEKVFGISVFSGEGIKELALEFLRLADDNQALESKQRKGLSGEAALEVQA
Sample Types
Isolate
7.7%
Metagenome
92.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.9%
Unclassified
25.9%
Kalotermitidae
24.1%
Termopsidae
5.2%
Rhinotermitidae
5.2%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
177
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 2 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 3 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 4 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 5 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 6 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 7 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 18 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 19 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 32 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 46 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 47 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 48 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 51 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 52 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 53 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 54 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 55 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 56 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 57 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 58 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 59 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 60 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_142165 | 3300042591 | Bacteria | 18180 |
| 2 | Ga0466694_028560 | 3300042594 | Bacteria | 27113 |
| 3 | Ga0466719_089683 | 3300042606 | Bacteria | 7170 |
| 4 | Ga0466720_023427 | 3300042607 | Bacteria | 1524 |
| 5 | Ga0466720_058276 | 3300042607 | Bacteria | 42688 |
| 6 | Ga0466722_010680 | 3300042609 | Bacteria | 5373 |
| 7 | Ga0466722_048209 | 3300042609 | Bacteria | 4823 |
| 8 | Ga0466722_227399 | 3300042609 | Bacteria | 1493 |
| 9 | JGI24698J34947_10082683 | 3300002449 | Bacteria | 1500 |
| 10 | Ga0072940_1466100 | 3300005200 | Bacteria | 2156 |
| 11 | Ga0466703_231460 | 3300042636 | Bacteria | 5029 |
| 12 | Ga0466704_079747 | 3300042643 | Bacteria | 12802 |
| 13 | Ga0466704_114284 | 3300042643 | Bacteria | 5903 |
| 14 | Ga0466727_022593 | 3300042655 | Bacteria | 6490 |
| 15 | Ga0466727_170314 | 3300042655 | Bacteria | 2400 |
| 16 | Ga0466712_033689 | 3300042614 | Bacteria | 1929 |
| 17 | Ga0466718_159704 | 3300042617 | Bacteria | 1608 |
| 18 | Ga0466726_124238 | 3300042619 | Bacteria | 4310 |
| 19 | Ga0466726_137107 | 3300042619 | Bacteria | 4573 |
| 20 | Ga0466728_034112 | 3300042620 | Bacteria | 27725 |
| 21 | Ga0466692_083289 | 3300042591 | Bacteria | 3812 |
| 22 | Ga0466696_027027 | 3300042596 | Bacteria | 1109 |
| 23 | Ga0466713_147757 | 3300042602 | Bacteria | 6953 |
| 24 | Ga0466716_330236 | 3300042605 | Bacteria | 1766 |
| 25 | Ga0466720_006242 | 3300042607 | Bacteria | 11760 |
| 26 | Ga0466720_027935 | 3300042607 | Bacteria | 23895 |
| 27 | Ga0466720_100472 | 3300042607 | Bacteria | 1454 |
| 28 | Ga0466720_157778 | 3300042607 | Bacteria | 10739 |
| 29 | Ga0466722_108310 | 3300042609 | Bacteria | 20847 |
| 30 | JGI24700J35501_10930500 | 3300002508 | Bacteria | 14760 |
| 31 | Ga0072940_1006184 | 3300005200 | Bacteria | 11783 |
| 32 | Ga0072940_1232177 | 3300005200 | Bacteria | 3875 |
| 33 | Ga0074263_101998 | 3300005485 | Bacteria | 2820 |
| 34 | Ga0074263_104786 | 3300005485 | Bacteria | 2114 |
| 35 | Ga0466729_234233 | 3300042621 | Bacteria | 2697 |
| 36 | Ga0466727_332593 | 3300042655 | Bacteria | 3107 |
| 37 | Ga0466718_041146 | 3300042617 | Bacteria | 3817 |
| 38 | Ga0466723_085936 | 3300042618 | Bacteria | 4250 |
| 39 | Ga0466732_011324 | 3300042656 | Bacteria | 3888 |
| 40 | Ga0264413_110888 | 3300024493 | Bacteria | 2751 |
| 41 | Ga0466690_423186 | 3300042590 | Bacteria | 1946 |
| 42 | Ga0466694_131161 | 3300042594 | Bacteria | 1333 |
| 43 | Ga0466696_256157 | 3300042596 | Bacteria | 36381 |
| 44 | Ga0466713_036587 | 3300042602 | Unclassified | 4055 |
| 45 | Ga0466720_023187 | 3300042607 | Bacteria | 4300 |
| 46 | Ga0466720_093607 | 3300042607 | Bacteria | 30455 |
| 47 | Ga0466720_209844 | 3300042607 | Bacteria | 24188 |
| 48 | Ga0466722_251251 | 3300042609 | Bacteria | 3594 |
| 49 | AustNasuHG_c1017156 | 3300000089 | Bacteria | 2412 |
| 50 | JGI24698J34947_10004794 | 3300002449 | Bacteria | 7395 |
| 51 | JGI24695J34938_10000517 | 3300002450 | Bacteria | 37577 |
| 52 | JGI24695J34938_10017765 | 3300002450 | Bacteria | 3573 |
| 53 | Ga0466731_101169 | 3300042622 | Bacteria | 2584 |
| 54 | Ga0466702_347596 | 3300042635 | Bacteria | 3129 |
| 55 | Ga0466727_082289 | 3300042655 | Bacteria | 8197 |
| 56 | Ga0123356_10000673 | 3300010049 | Bacteria | 37817 |
| 57 | Ga0123356_10383748 | 3300010049 | Bacteria | 1538 |
| 58 | Ga0466712_013410 | 3300042614 | Bacteria | 3609 |
| 59 | Ga0466712_065835 | 3300042614 | Bacteria | 6561 |
| 60 | Ga0466723_069830 | 3300042618 | Bacteria | 59394 |
| 61 | Ga0466723_228042 | 3300042618 | Bacteria | 7274 |
| 62 | Ga0466705_039391 | 3300042612 | Bacteria | 23770 |
| 63 | Ga0466732_453554 | 3300042656 | Bacteria | 3075 |
| 64 | Ga0466692_099580 | 3300042591 | Bacteria | 1127 |
| 65 | Ga0466699_056422 | 3300042597 | Bacteria | 6374 |
| 66 | Ga0466699_369814 | 3300042597 | Bacteria | 1964 |
| 67 | Ga0466706_180648 | 3300042599 | Bacteria | 2391 |
| 68 | Ga0466700_124952 | 3300042600 | Bacteria | 1453 |
| 69 | Ga0466720_021273 | 3300042607 | Bacteria | 41620 |
| 70 | Ga0466722_213869 | 3300042609 | Bacteria | 8503 |
| 71 | JGI24698J34947_10006644 | 3300002449 | Bacteria | 6351 |
| 72 | JGI24698J34947_10008296 | 3300002449 | Bacteria | 5695 |
| 73 | JGI24695J34938_10065496 | 3300002450 | Bacteria | 1534 |
| 74 | Ga0466735_025071 | 3300042624 | Bacteria | 13306 |
| 75 | Ga0466735_223886 | 3300042624 | Bacteria | 1903 |
| 76 | Ga0123356_10690440 | 3300010049 | Bacteria | 1189 |
| 77 | Ga0123353_10305841 | 3300010167 | Bacteria | 2423 |
| 78 | Ga0466712_187946 | 3300042614 | Bacteria | 1958 |
| 79 | Ga0466711_050128 | 3300042615 | Bacteria | 17464 |
| 80 | Ga0466718_035208 | 3300042617 | Bacteria | 1513 |
| 81 | Ga0466726_340546 | 3300042619 | Bacteria | 2182 |
| 82 | Ga0466728_293951 | 3300042620 | Bacteria | 1902 |
| 83 | Ga0466705_197661 | 3300042612 | Bacteria | 2580 |
| 84 | Ga0466657_230430 | 3300042582 | Bacteria | 2497 |
| 85 | Ga0466690_408771 | 3300042590 | Bacteria | 5360 |
| 86 | Ga0466692_045234 | 3300042591 | Bacteria | 21389 |
| 87 | Ga0466692_095794 | 3300042591 | Bacteria | 24513 |
| 88 | Ga0466694_166314 | 3300042594 | Bacteria | 23774 |
| 89 | Ga0466699_144187 | 3300042597 | Bacteria | 18805 |
| 90 | Ga0466700_351950 | 3300042600 | Bacteria | 4533 |
| 91 | Ga0466720_001820 | 3300042607 | Bacteria | 3499 |
| 92 | Ga0466722_083402 | 3300042609 | Bacteria | 1568 |
| 93 | Ga0466698_413354 | 3300042610 | Bacteria | 3538 |
| 94 | JGI24695J34938_10006111 | 3300002450 | Bacteria | 7329 |
| 95 | JGI24702J35022_10002303 | 3300002462 | Bacteria | 11706 |
| 96 | Ga0466731_125974 | 3300042622 | Unclassified | 5967 |
| 97 | Ga0466709_113537 | 3300042648 | Bacteria | 10119 |
| 98 | Ga0466708_285465 | 3300042652 | Bacteria | 1747 |
| 99 | Ga0466711_017592 | 3300042615 | Bacteria | 12864 |
| 100 | Ga0466711_057929 | 3300042615 | Bacteria | 2335 |
| 101 | Ga0466718_023428 | 3300042617 | Bacteria | 58531 |
| 102 | Ga0466718_137930 | 3300042617 | Bacteria | 1042 |
| 103 | Ga0466705_006274 | 3300042612 | Bacteria | 6742 |
| 104 | Ga0466693_154548 | 3300042592 | Bacteria | 1473 |
| 105 | Ga0466694_078502 | 3300042594 | Bacteria | 33638 |
| 106 | Ga0466699_146529 | 3300042597 | Bacteria | 18494 |
| 107 | Ga0466699_153073 | 3300042597 | Bacteria | 21357 |
| 108 | Ga0466720_115891 | 3300042607 | Bacteria | 4677 |
| 109 | Ga0466722_022875 | 3300042609 | Bacteria | 6212 |
| 110 | Ga0466722_040150 | 3300042609 | Bacteria | 5220 |
| 111 | AustNasuHG_c1000379 | 3300000089 | Bacteria | 15425 |
| 112 | Ga0068305_10083630 | 3300005083 | Bacteria | 2641 |
| 113 | Ga0466704_394489 | 3300042643 | Bacteria | 2333 |
| 114 | Ga0466708_099906 | 3300042652 | Bacteria | 39915 |
| 115 | Ga0123356_10067674 | 3300010049 | Bacteria | 3345 |
| 116 | Ga0123356_10295719 | 3300010049 | Bacteria | 1722 |
| 117 | Ga0123354_10150541 | 3300010882 | Bacteria | 2821 |
| 118 | Ga0466712_137759 | 3300042614 | Bacteria | 3643 |
| 119 | Ga0466715_134923 | 3300042616 | Bacteria | 9396 |
| 120 | Ga0466692_146154 | 3300042591 | Bacteria | 2172 |
| 121 | Ga0466691_085140 | 3300042593 | Bacteria | 8670 |
| 122 | Ga0466694_309425 | 3300042594 | Bacteria | 7720 |
| 123 | Ga0466699_117382 | 3300042597 | Bacteria | 7366 |
| 124 | Ga0466699_206786 | 3300042597 | Bacteria | 2770 |
| 125 | Ga0466699_364451 | 3300042597 | Bacteria | 5728 |
| 126 | Ga0466700_452930 | 3300042600 | Bacteria | 3333 |
| 127 | Ga0466719_225394 | 3300042606 | Bacteria | 70315 |
| 128 | Ga0466720_076308 | 3300042607 | Bacteria | 13359 |
| 129 | Ga0466698_405442 | 3300042610 | Bacteria | 1430 |
| 130 | Ga0466698_449792 | 3300042610 | Bacteria | 7889 |
| 131 | Ga0466731_033473 | 3300042622 | Bacteria | 1799 |
| 132 | Ga0466735_066995 | 3300042624 | Bacteria | 3011 |
| 133 | Ga0466703_320941 | 3300042636 | Bacteria | 1152 |
| 134 | Ga0466704_286649 | 3300042643 | Bacteria | 10797 |
| 135 | Ga0466708_305208 | 3300042652 | Bacteria | 9462 |
| 136 | Ga0466727_210330 | 3300042655 | Bacteria | 1211 |
| 137 | Ga0123356_10001174 | 3300010049 | Bacteria | 28989 |
| 138 | Ga0123353_10224144 | 3300010167 | Bacteria | 2937 |
| 139 | Ga0466718_054074 | 3300042617 | Bacteria | 3822 |
| 140 | Ga0466732_116533 | 3300042656 | Bacteria | 17693 |
| 141 | Ga0466732_242928 | 3300042656 | Unclassified | 1535 |
| 142 | Ga0466691_027110 | 3300042593 | Bacteria | 2827 |
| 143 | Ga0466694_081297 | 3300042594 | Bacteria | 3718 |
| 144 | Ga0466700_160256 | 3300042600 | Bacteria | 3692 |
| 145 | Ga0466719_047594 | 3300042606 | Bacteria | 10214 |
| 146 | Ga0466720_023375 | 3300042607 | Unclassified | 14601 |
| 147 | Ga0466720_026260 | 3300042607 | Bacteria | 25590 |
| 148 | Ga0466698_318181 | 3300042610 | Bacteria | 1503 |
| 149 | AustNasuHG_c1001425 | 3300000089 | Bacteria | 8552 |
| 150 | JGI24695J34938_10004857 | 3300002450 | Bacteria | 8622 |
| 151 | JGI24702J35022_10001485 | 3300002462 | Bacteria | 14553 |
| 152 | Ga0072941_1000679 | 3300005201 | Bacteria | 14735 |
| 153 | Ga0072941_1023286 | 3300005201 | Bacteria | 7884 |
| 154 | Ga0466703_132099 | 3300042636 | Bacteria | 29234 |
| 155 | Ga0466708_281540 | 3300042652 | Bacteria | 20650 |
| 156 | Ga0123356_10000865 | 3300010049 | Bacteria | 33632 |
| 157 | Ga0123356_10356910 | 3300010049 | Bacteria | 1587 |
| 158 | Ga0123353_10015338 | 3300010167 | Bacteria | 11124 |
| 159 | Ga0123353_10053328 | 3300010167 | Bacteria | 6463 |
| 160 | Ga0466712_154031 | 3300042614 | Bacteria | 14619 |
| 161 | Ga0466715_080016 | 3300042616 | Bacteria | 22104 |
| 162 | Ga0466715_251035 | 3300042616 | Bacteria | 6415 |
| 163 | Ga0466715_336800 | 3300042616 | Bacteria | 1775 |
| 164 | Ga0466715_413563 | 3300042616 | Bacteria | 7035 |
| 165 | Ga0466715_472351 | 3300042616 | Bacteria | 8767 |
| 166 | Ga0466715_514149 | 3300042616 | Bacteria | 8777 |
| 167 | Ga0466726_042391 | 3300042619 | Bacteria | 39221 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01926 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.