Protein Family IF06656

Metagenome Metatranscriptome Isolate
174 Members
48 Samples
155 Scaffolds
143.32 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_113267|Ga0466720_113267_1232_1750
Length
172 aa
Sequence
MGSVEVQAGGGQKYRLAHLTLFTFLGHISKMNTVFVKPASVERKWYVIDAEGKVMGRVAAKVASIVRGKNKAIFAPHQEMGDYVVVINADKVNVTGRKTQQKMYYRHSGYVGGLKAITFEKLIARHPTQPLENAIKGMLPKGPLGRKLAKNAKIYAGAAHPHAAQNPTAIDL

📊 Sample Types

Isolate 10.9%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 55.6%
Unclassified 42.2%
Rhinotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
7 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
8 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
9 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
10 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
11 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
12 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
13 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
14 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
20 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
21 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
22 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
23 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
24 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
27 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
28 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
29 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
34 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
35 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
36 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
37 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
38 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300021218 Termite gut microbial communities from nest from French Guiana - FG16_L2_4 mRNA SA Metatranscriptome
43 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
44 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
45 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
46 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
47 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
48 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_121673 3300042622 Bacteria 1736
2 Ga0466731_128667 3300042622 Bacteria 14380
3 Ga0466702_092930 3300042635 Unclassified 1824
4 Ga0123356_10000152 3300010049 Bacteria 78065
5 Ga0466694_169170 3300042594 Bacteria 5410
6 Ga0466700_177342 3300042600 Bacteria 1149
7 Ga0466700_191856 3300042600 Bacteria 1217
8 Ga0466720_086674 3300042607 Bacteria 26644
9 AustNasuHG_c1002024 3300000089 Bacteria 7301
10 AustNasuHG_c1020983 3300000089 Unclassified 2120
11 AustNasuHG_c1067242 3300000089 Bacteria 662
12 JGI24698J34947_10000406 3300002449 Bacteria 19632
13 JGI24695J34938_10000350 3300002450 Bacteria 45521
14 JGI24695J34938_10001001 3300002450 Bacteria 25675
15 JGI24695J34938_10004544 3300002450 Bacteria 9046
16 JGI24695J34938_10005415 3300002450 Bacteria 7967
17 JGI24699J35502_11116415 3300002509 Unclassified 2968
18 Ga0072941_1012019 3300005201 Unclassified 16271
19 Ga0466712_003796 3300042614 Bacteria 14120
20 Ga0466712_026119 3300042614 Bacteria 16171
21 Ga0466718_002493 3300042617 Bacteria 2781
22 Ga0466718_108522 3300042617 Bacteria 34323
23 Ga0466731_041738 3300042622 Bacteria 1027
24 Ga0466730_027235 3300042625 Bacteria 1504
25 Ga0123356_10711013 3300010049 Bacteria 1174
26 Ga0123356_10809043 3300010049 Bacteria 1108
27 Ga0123356_13274612 3300010049 Unclassified 563
28 Ga0123353_10086950 3300010167 Bacteria 5036
29 Ga0123353_11792546 3300010167 Bacteria 763
30 Ga0223679_111306 3300021218 Bacteria 509
31 Ga0415639_000341 3300038395 Bacteria 8443
32 Ga0466699_150152 3300042597 Bacteria 4528
33 Ga0466698_383635 3300042610 Bacteria 14424
34 AustNasuHG_c1015084 3300000089 Bacteria 2614
35 FAAS_10400834 3300001880 Unclassified 541
36 JGI24698J34947_10039170 3300002449 Unclassified 2455
37 JGI24695J34938_10020047 3300002450 Bacteria 3299
38 Ga0072940_1049966 3300005200 Unclassified 1382
39 Ga0466712_023398 3300042614 Bacteria 5375
40 Ga0466732_130011 3300042656 Bacteria 1791
41 Ga0123356_12707820 3300010049 Bacteria 621
42 Ga0123353_10394946 3300010167 Bacteria 2061
43 Ga0466720_068836 3300042607 Bacteria 9291
44 Ga0466720_109571 3300042607 Bacteria 11688
45 Ga0466721_293255 3300042608 Bacteria 1972
46 Ga0466722_077441 3300042609 Bacteria 4020
47 Ga0466722_222135 3300042609 Bacteria 12545
48 AustNasuHG_c1056613 3300000089 Bacteria 788
49 JGI24698J34947_10080743 3300002449 Bacteria 1527
50 JGI24695J34938_10001647 3300002450 Bacteria 18582
51 JGI24695J34938_10003153 3300002450 Bacteria 11730
52 Ga0466712_001453 3300042614 Bacteria 11752
53 Ga0466712_030929 3300042614 Bacteria 4807
54 Ga0466712_277071 3300042614 Bacteria 19775
55 Ga0466712_321597 3300042614 Bacteria 5453
56 Ga0466718_015171 3300042617 Bacteria 10886
57 Ga0466732_102796 3300042656 Bacteria 1715
58 Ga0466731_353475 3300042622 Bacteria 6886
59 Ga0466731_412863 3300042622 Bacteria 1408
60 Ga0466702_120851 3300042635 Bacteria 1486
61 Ga0466702_375699 3300042635 Bacteria 1594
62 Ga0123356_10001758 3300010049 Bacteria 23601
63 Ga0123356_11696822 3300010049 Bacteria 784
64 Ga0123353_10798431 3300010167 Unclassified 1304
65 Ga0466656_383391 3300042550 Bacteria 1096
66 Ga0466694_042247 3300042594 Bacteria 35764
67 Ga0466699_006172 3300042597 Bacteria 1456
68 Ga0466699_191763 3300042597 Bacteria 1146
69 Ga0466699_439515 3300042597 Bacteria 1886
70 Ga0466720_152084 3300042607 Bacteria 11962
71 Ga0466721_080676 3300042608 Bacteria 47264
72 FAAS_10006615 3300001880 Bacteria 788
73 JGI24695J34938_10011579 3300002450 Bacteria 4742
74 JGI24695J34938_10019172 3300002450 Bacteria 3398
75 Ga0466702_044195 3300042635 Bacteria 15638
76 Ga0466702_315454 3300042635 Bacteria 5696
77 Ga0123356_10004155 3300010049 Bacteria 15027
78 Ga0123356_10105104 3300010049 Bacteria 2716
79 Ga0123356_10189988 3300010049 Bacteria 2084
80 Ga0123356_10541768 3300010049 Bacteria 1324
81 Ga0466720_003412 3300042607 Unclassified 1056
82 Ga0466720_014626 3300042607 Bacteria 80288
83 Ga0466698_219696 3300042610 Bacteria 1845
84 AustNasuHG_c1001696 3300000089 Bacteria 7953
85 AustNasuHG_c1042995 3300000089 Bacteria 1067
86 FAAS_10006681 3300001880 Unclassified 991
87 JGI24695J34938_10010283 3300002450 Unclassified 5138
88 JGI24695J34938_10031240 3300002450 Bacteria 2473
89 JGI24695J34938_10065738 3300002450 Bacteria 1531
90 JGI24695J34938_10069158 3300002450 Bacteria 1481
91 JGI24695J34938_10248560 3300002450 Bacteria 754
92 Ga0466712_146184 3300042614 Bacteria 1713
93 Ga0466718_009636 3300042617 Bacteria 7626
94 Ga0466718_096010 3300042617 Unclassified 3542
95 Ga0466731_226195 3300042622 Bacteria 1087
96 Ga0466702_050633 3300042635 Bacteria 3144
97 Ga0466702_060519 3300042635 Bacteria 1634
98 Ga0123356_10000283 3300010049 Bacteria 58609
99 Ga0123356_10038078 3300010049 Bacteria 4483
100 Ga0123356_10168933 3300010049 Bacteria 2195
101 Ga0415639_020608 3300038395 Bacteria 1317
102 AustNasuHG_c1026335 3300000089 Unclassified 1812
103 JGI24698J34947_10005103 3300002449 Bacteria 7195
104 JGI24698J34947_10016490 3300002449 Bacteria 4010
105 JGI24698J34947_10026887 3300002449 Unclassified 3055
106 JGI24698J34947_10056013 3300002449 Unclassified 1962
107 JGI24698J34947_10090355 3300002449 Bacteria 1407
108 JGI24695J34938_10000551 3300002450 Bacteria 36191
109 JGI24695J34938_10001017 3300002450 Bacteria 25353
110 JGI24695J34938_10002611 3300002450 Bacteria 13550
111 JGI24695J34938_10003574 3300002450 Bacteria 10711
112 JGI24695J34938_10011871 3300002450 Bacteria 4658
113 Ga0072941_1012466 3300005201 Bacteria 11515
114 Ga0072941_1017427 3300005201 Bacteria 23253
115 Ga0466712_205092 3300042614 Bacteria 20979
116 Ga0466712_235872 3300042614 Bacteria 8616
117 Ga0123356_10071285 3300010049 Bacteria 3262
118 Ga0415639_003056 3300038395 Bacteria 16768
119 Ga0415639_008020 3300038395 Bacteria 3145
120 Ga0466694_009362 3300042594 Bacteria 28493
121 Ga0466699_040083 3300042597 Bacteria 5933
122 Ga0466699_168042 3300042597 Bacteria 1964
123 Ga0466717_264689 3300042604 Bacteria 1095
124 Ga0466720_074939 3300042607 Bacteria 10381
125 Ga0466720_113267 3300042607 Bacteria 2325
126 Ga0466721_354360 3300042608 Bacteria 1541
127 JGI24698J34947_10034564 3300002449 Bacteria 2644
128 JGI24695J34938_10007596 3300002450 Bacteria 6313
129 JGI24695J34938_10010536 3300002450 Bacteria 5049
130 JGI24695J34938_10243825 3300002450 Bacteria 760
131 Ga0072941_1015462 3300005201 Bacteria 14518
132 Ga0466712_029701 3300042614 Bacteria 1403
133 Ga0466712_145862 3300042614 Unclassified 4046
134 Ga0466732_024721 3300042656 Bacteria 22695
135 Ga0466731_389079 3300042622 Bacteria 6620
136 Ga0466731_415872 3300042622 Bacteria 1752
137 Ga0123355_10121769 3300009826 Bacteria 4044
138 Ga0123356_10002756 3300010049 Bacteria 18666
139 Ga0123356_10003666 3300010049 Bacteria 16004
140 Ga0123356_10019383 3300010049 Bacteria 6448
141 Ga0123353_10504357 3300010167 Bacteria 1762
142 Ga0123353_12607005 3300010167 Bacteria 598
143 Ga0123353_12697618 3300010167 Bacteria 585
144 Ga0123353_12821768 3300010167 Bacteria 568
145 Ga0466693_085049 3300042592 Bacteria 1813
146 Ga0466694_061950 3300042594 Bacteria 20356
147 Ga0466699_281342 3300042597 Bacteria 10527
148 Ga0466720_040089 3300042607 Unclassified 1910
149 Ga0466720_150961 3300042607 Bacteria 3786
150 AustNasuHG_c1001161 3300000089 Unclassified 9437
151 JGI24698J34947_10001212 3300002449 Bacteria 13496
152 JGI24698J34947_10049286 3300002449 Bacteria 2129
153 JGI24695J34938_10000778 3300002450 Bacteria 29892
154 JGI24697J35500_11266197 3300002507 Bacteria 3493
155 Ga0466718_019967 3300042617 Bacteria 11650

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00572 Ribosomal_L13 Ribosomal protein L13 43 161 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.