Protein Family IF06654

Metagenome Isolate
164 Members
50 Samples
149 Scaffolds
369.5 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_111533|Ga0466720_111533_8589_9860
Length
423 aa
Sequence
MRREFQTAIQPQAGLCGIRLLFMSDIKFSLFKHKPLKHPFQQVDNYIYMKKYVLLSILILASINLTVFAQDLNISKDDLVMESRPDGGFHLFIKKKPDINSVLLTETTKDPKMQADNYAYRAAEWNPINGDEVRLLNGEPIPKESKIYSLISSTIENHPVLGQAFHVYIPYILYYGYENSRHGEVPLKDGTFLNIRAFSMKYADYRGSFKDNPFVLEAKQEPPVNKKEGEYIPETLSAFTEIAKSSGGSLIYCNDPDEVVDLIQNILNKETGKKVDIVLCLDTTLSMKKYIDPLRVKLVPALDQLIKKFSSFRIGMVLFKDYYDIYLTKIVPFTSDFKRFQRDLNEIRVLGGGDIPEAVYEALYDGAAKFSWEAESKIMILIGDAPPHPKPRGKITKEMQEKAAKDKNIKVSAILLPQSTPSK

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Unclassified 33.3%
Kalotermitidae 14.6%
Termopsidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
4 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
14 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
21 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
22 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
25 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
31 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
32 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
35 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
43 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
44 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_060742 3300042616 Bacteria 12845
2 Ga0466718_016124 3300042617 Bacteria 4887
3 Ga0123356_10003448 3300010049 Bacteria 16546
4 Ga0123353_10524686 3300010167 Bacteria 1717
5 Ga0466691_210437 3300042593 Bacteria 21822
6 JGI24698J34947_10008999 3300002449 Bacteria 5476
7 JGI24698J34947_10019808 3300002449 Bacteria 3625
8 JGI24698J34947_10039499 3300002449 Bacteria 2442
9 JGI24695J34938_10000436 3300002450 Bacteria 40240
10 JGI24695J34938_10001767 3300002450 Bacteria 17840
11 JGI24695J34938_10042283 3300002450 Bacteria 2040
12 JGI24695J34938_10068698 3300002450 Bacteria 1487
13 Ga0072941_1012131 3300005201 Bacteria 10383
14 Ga0466712_208329 3300042614 Bacteria 38852
15 Ga0466718_028529 3300042617 Bacteria 3611
16 Ga0466700_017314 3300042600 Bacteria 8012
17 Ga0264413_120001 3300024493 Unclassified 2601
18 Ga0466699_039070 3300042597 Bacteria 2656
19 Ga0466699_146102 3300042597 Bacteria 1542
20 AustNasuHG_c1004467 3300000089 Bacteria 5015
21 JGI24695J34938_10000703 3300002450 Bacteria 31469
22 Ga0072940_1099499 3300005200 Bacteria 2641
23 Ga0072941_1013241 3300005201 Bacteria 3615
24 Ga0072941_1108788 3300005201 Bacteria 2492
25 Ga0072941_1191953 3300005201 Bacteria 2029
26 Ga0466731_289877 3300042622 Bacteria 2697
27 Ga0466704_183980 3300042643 Bacteria 4398
28 Ga0466704_199599 3300042643 Bacteria 4500
29 Ga0466732_305049 3300042656 Bacteria 4597
30 Ga0466712_009525 3300042614 Bacteria 9104
31 Ga0466712_158281 3300042614 Bacteria 7051
32 Ga0466712_191566 3300042614 Bacteria 26176
33 Ga0466718_168728 3300042617 Bacteria 4628
34 Ga0123356_10000993 3300010049 Bacteria 31501
35 Ga0123356_10016635 3300010049 Bacteria 7015
36 Ga0123356_10040772 3300010049 Bacteria 4325
37 Ga0415639_013315 3300038395 Bacteria 6630
38 Ga0415639_156994 3300038395 Bacteria 3045
39 Ga0466690_163802 3300042590 Bacteria 6573
40 Ga0466693_380243 3300042592 Bacteria 4257
41 Ga0466695_115832 3300042595 Bacteria 38752
42 Nasutiter_Contig09991 2030936001 Bacteria 1821
43 JGI24695J34938_10037599 3300002450 Bacteria 2198
44 Ga0072940_1004918 3300005200 Bacteria 32026
45 Ga0072941_1063215 3300005201 Bacteria 3721
46 Ga0072941_1144787 3300005201 Bacteria 2760
47 Ga0466731_202208 3300042622 Bacteria 7260
48 Ga0466702_174822 3300042635 Bacteria 2892
49 Ga0466702_355084 3300042635 Bacteria 14985
50 Ga0466732_305116 3300042656 Bacteria 1857
51 Ga0466712_000292 3300042614 Bacteria 7191
52 Ga0466712_002362 3300042614 Bacteria 5758
53 Ga0466712_003835 3300042614 Bacteria 33483
54 Ga0466712_044717 3300042614 Bacteria 9555
55 Ga0466723_048823 3300042618 Bacteria 8494
56 Ga0466726_490747 3300042619 Bacteria 3914
57 Ga0123356_10000042 3300010049 Bacteria 135091
58 Ga0123353_10100079 3300010167 Bacteria 4672
59 Ga0466720_095422 3300042607 Unclassified 6881
60 Ga0466720_111533 3300042607 Bacteria 18124
61 Ga0466720_218782 3300042607 Bacteria 30566
62 Ga0415639_101432 3300038395 Bacteria 3347
63 JGI24698J34947_10007253 3300002449 Bacteria 6091
64 JGI24698J34947_10019705 3300002449 Unclassified 3635
65 JGI24698J34947_10081927 3300002449 Unclassified 1511
66 JGI24695J34938_10001560 3300002450 Bacteria 19317
67 JGI24695J34938_10014142 3300002450 Bacteria 4153
68 Ga0072940_1044266 3300005200 Bacteria 1765
69 Ga0072941_1000379 3300005201 Bacteria 3200
70 Ga0466731_113440 3300042622 Bacteria 5685
71 Ga0466731_213274 3300042622 Bacteria 1325
72 Ga0466712_014480 3300042614 Bacteria 1895
73 Ga0466715_114864 3300042616 Bacteria 21180
74 Ga0466723_206366 3300042618 Bacteria 13029
75 Ga0123355_10040996 3300009826 Bacteria 7537
76 Ga0123356_10006525 3300010049 Bacteria 11753
77 Ga0123356_10041023 3300010049 Bacteria 4313
78 Ga0264413_121346 3300024493 Bacteria 5794
79 Ga0415639_048114 3300038395 Bacteria 4027
80 Ga0415639_086514 3300038395 Bacteria 6128
81 Ga0466694_028112 3300042594 Bacteria 18412
82 AustNasuHG_c1001736 3300000089 Bacteria 7875
83 AustNasuHG_c1007531 3300000089 Bacteria 3868
84 JGI24698J34947_10010496 3300002449 Bacteria 5082
85 JGI24698J34947_10010990 3300002449 Bacteria 4969
86 JGI24695J34938_10000171 3300002450 Bacteria 60520
87 JGI24695J34938_10001889 3300002450 Bacteria 16968
88 Ga0072941_1019848 3300005201 Bacteria 10279
89 Ga0072941_1077832 3300005201 Bacteria 3823
90 Ga0466705_069348 3300042612 Bacteria 3172
91 Ga0466731_040968 3300042622 Bacteria 19783
92 Ga0466730_073289 3300042625 Bacteria 2043
93 Ga0466712_212937 3300042614 Bacteria 1896
94 Ga0466718_012410 3300042617 Bacteria 2142
95 Ga0123357_10125020 3300009784 Bacteria 3225
96 Ga0123356_10039038 3300010049 Bacteria 4424
97 Ga0466707_101661 3300042601 Bacteria 1517
98 Ga0466716_184098 3300042605 Bacteria 3799
99 Ga0466698_022701 3300042610 Bacteria 11044
100 Ga0415639_016117 3300038395 Bacteria 9784
101 Ga0415639_054108 3300038395 Bacteria 1531
102 Ga0466656_217747 3300042550 Bacteria 1445
103 Ga0466691_216852 3300042593 Bacteria 16339
104 Ga0466694_050395 3300042594 Bacteria 2710
105 Ga0466694_075010 3300042594 Bacteria 11883
106 Ga0466694_126873 3300042594 Bacteria 6368
107 Ga0466699_116490 3300042597 Bacteria 4215
108 AustNasuHG_c1000746 3300000089 Bacteria 11583
109 AustNasuHG_c1007889 3300000089 Bacteria 3775
110 JGI24698J34947_10029722 3300002449 Bacteria 2886
111 JGI24698J34947_10029865 3300002449 Bacteria 2877
112 Ga0072941_1106971 3300005201 Bacteria 3822
113 Ga0466705_116506 3300042612 Bacteria 4792
114 Ga0466702_375121 3300042635 Bacteria 3191
115 Ga0466704_580276 3300042643 Bacteria 17916
116 Ga0466732_094302 3300042656 Bacteria 6089
117 Ga0466718_013234 3300042617 Bacteria 5969
118 Ga0466723_310462 3300042618 Bacteria 1398
119 Ga0123356_10000344 3300010049 Bacteria 53657
120 Ga0123356_10002711 3300010049 Bacteria 18816
121 Ga0123356_10014508 3300010049 Bacteria 7574
122 Ga0466720_017262 3300042607 Bacteria 1335
123 Ga0264413_105813 3300024493 Bacteria 20905
124 Ga0415639_150777 3300038395 Bacteria 7550
125 Ga0466699_424862 3300042597 Bacteria 31048
126 JGI24698J34947_10003561 3300002449 Bacteria 8458
127 JGI24695J34938_10001243 3300002450 Bacteria 22394
128 JGI24695J34938_10017391 3300002450 Bacteria 3623
129 Ga0466712_131899 3300042614 Bacteria 2397
130 Ga0466712_309816 3300042614 Bacteria 24285
131 Ga0466718_032527 3300042617 Bacteria 6027
132 Ga0466718_097486 3300042617 Bacteria 5174
133 Ga0466718_129258 3300042617 Bacteria 9781
134 Ga0123356_10113863 3300010049 Bacteria 2618
135 Ga0466716_152609 3300042605 Bacteria 6971
136 Ga0466720_036593 3300042607 Unclassified 2531
137 Ga0466720_234261 3300042607 Bacteria 7285
138 Ga0466694_075104 3300042594 Bacteria 33181
139 Ga0466699_139207 3300042597 Bacteria 2253
140 JGI24698J34947_10042086 3300002449 Bacteria 2349
141 JGI24698J34947_10058502 3300002449 Unclassified 1908
142 JGI24698J34947_10068646 3300002449 Bacteria 1714
143 JGI24698J34947_10077945 3300002449 Bacteria 1565
144 JGI24695J34938_10000062 3300002450 Bacteria 88353
145 JGI24695J34938_10001218 3300002450 Bacteria 22750
146 JGI24695J34938_10004209 3300002450 Bacteria 9567
147 JGI24695J34938_10023298 3300002450 Bacteria 2988
148 Ga0072940_1014331 3300005200 Bacteria 3382
149 Ga0466704_076783 3300042643 Bacteria 2173

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.