Protein Family IF06622
Metagenome
168
Members
30
Samples
168
Scaffolds
430.36
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_036008|Ga0466720_036008_1531_2877
- Length
- 426 aa
- Sequence
- MGKTLTQKIFDAHTADQPFEDVFVLRLDRVFCHEITTPFAINDLVSKKLDKVFDPSKIKAVIDHVSPAKDSLTARQGKTLRDWARRHNIKDFFDIGRNGVCHAIFPEKGFVRPGFTIIMGDSHTCTHGAFGAFAAGVGTTDLEVGILKGVCAFRKPETLRINLLGQLPSGVFPKDVILAVISKIGVSGASGKVMELRGPVISAMSMEGRMTICNMAIEAGGTSGVCMPDMATVDYLWPFIGPGACVAGGGEKTYSSKEEALKDFSKWTSDDDAEYSGIVDIDCSKLEPLATVGYKPDEVKTIRELAGTKIDQVYIGSCTNGRIEDLRAAAAVLRGKKIADSVRAIVSPATTDIYAQALKEGLIQIFLDSGCCVTNATCGACLGMSNGVLAEGEVCASTTNRNFYGRMGKDGMVHLMSPASDAGGKS
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
48.3%
Termitidae
27.6%
Rhinotermitidae
10.3%
Termopsidae
10.3%
Unclassified
3.4%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_079075 | 3300042590 | Bacteria | 2135 |
| 2 | Ga0466690_137190 | 3300042590 | Bacteria | 25103 |
| 3 | Ga0466692_134620 | 3300042591 | Bacteria | 2980 |
| 4 | Ga0466691_224755 | 3300042593 | Bacteria | 5179 |
| 5 | AustNasuHG_c1000414 | 3300000089 | Bacteria | 14791 |
| 6 | Ga0466716_027972 | 3300042605 | Bacteria | 11534 |
| 7 | Ga0466720_036008 | 3300042607 | Bacteria | 7114 |
| 8 | Ga0466720_052044 | 3300042607 | Bacteria | 6918 |
| 9 | Ga0466720_115101 | 3300042607 | Bacteria | 25660 |
| 10 | Ga0466715_116572 | 3300042616 | Bacteria | 3934 |
| 11 | Ga0466715_204600 | 3300042616 | Bacteria | 5268 |
| 12 | Ga0466718_056525 | 3300042617 | Bacteria | 1878 |
| 13 | Ga0466723_028889 | 3300042618 | Bacteria | 7896 |
| 14 | Ga0466699_007738 | 3300042597 | Bacteria | 9932 |
| 15 | Ga0466733_071725 | 3300042659 | Bacteria | 3310 |
| 16 | Ga0466707_405392 | 3300042601 | Bacteria | 5744 |
| 17 | Ga0466716_346718 | 3300042605 | Bacteria | 3971 |
| 18 | Ga0466719_508256 | 3300042606 | Bacteria | 33396 |
| 19 | Ga0466722_050765 | 3300042609 | Bacteria | 2715 |
| 20 | Ga0466735_096487 | 3300042624 | Bacteria | 2750 |
| 21 | Ga0466735_167324 | 3300042624 | Bacteria | 2798 |
| 22 | Ga0466703_165643 | 3300042636 | Bacteria | 12836 |
| 23 | Ga0466703_357755 | 3300042636 | Bacteria | 20094 |
| 24 | Ga0466704_206264 | 3300042643 | Bacteria | 1938 |
| 25 | Ga0466709_039703 | 3300042648 | Unclassified | 1900 |
| 26 | Ga0466709_403722 | 3300042648 | Unclassified | 5100 |
| 27 | Ga0466708_136958 | 3300042652 | Bacteria | 5214 |
| 28 | Ga0466712_055987 | 3300042614 | Bacteria | 1871 |
| 29 | Ga0466711_034262 | 3300042615 | Bacteria | 3312 |
| 30 | Ga0466711_459861 | 3300042615 | Bacteria | 7932 |
| 31 | Ga0466715_550875 | 3300042616 | Bacteria | 48407 |
| 32 | Ga0466718_025929 | 3300042617 | Bacteria | 14450 |
| 33 | Ga0466723_016520 | 3300042618 | Bacteria | 2674 |
| 34 | Ga0466723_051719 | 3300042618 | Bacteria | 32356 |
| 35 | Ga0466723_155240 | 3300042618 | Bacteria | 13359 |
| 36 | Ga0466726_118108 | 3300042619 | Bacteria | 2108 |
| 37 | Ga0466728_037276 | 3300042620 | Bacteria | 24162 |
| 38 | Ga0466690_384150 | 3300042590 | Bacteria | 5977 |
| 39 | Ga0466691_069374 | 3300042593 | Bacteria | 23474 |
| 40 | Ga0466696_063136 | 3300042596 | Bacteria | 12784 |
| 41 | Ga0466705_147163 | 3300042612 | Unclassified | 1979 |
| 42 | Ga0466719_143516 | 3300042606 | Bacteria | 6827 |
| 43 | Ga0466719_282591 | 3300042606 | Bacteria | 10043 |
| 44 | Ga0466719_357719 | 3300042606 | Bacteria | 4223 |
| 45 | Ga0466720_006836 | 3300042607 | Bacteria | 2383 |
| 46 | Ga0466720_179536 | 3300042607 | Bacteria | 2395 |
| 47 | Ga0466720_183894 | 3300042607 | Bacteria | 24073 |
| 48 | Ga0466722_227135 | 3300042609 | Bacteria | 7060 |
| 49 | Ga0466704_127461 | 3300042643 | Bacteria | 6054 |
| 50 | Ga0466709_096703 | 3300042648 | Bacteria | 10851 |
| 51 | Ga0466709_221364 | 3300042648 | Bacteria | 1360 |
| 52 | Ga0466708_032177 | 3300042652 | Bacteria | 7514 |
| 53 | Ga0466712_039794 | 3300042614 | Unclassified | 1684 |
| 54 | Ga0466711_094581 | 3300042615 | Bacteria | 5284 |
| 55 | Ga0466715_356256 | 3300042616 | Bacteria | 2901 |
| 56 | Ga0466715_499790 | 3300042616 | Bacteria | 22846 |
| 57 | Ga0466718_026845 | 3300042617 | Bacteria | 7547 |
| 58 | Ga0466723_015966 | 3300042618 | Bacteria | 3280 |
| 59 | Ga0466726_054838 | 3300042619 | Bacteria | 3241 |
| 60 | Ga0466726_271148 | 3300042619 | Bacteria | 8364 |
| 61 | Ga0456237_0000099 | 3300041968 | Bacteria | 12351 |
| 62 | Ga0466705_248149 | 3300042612 | Bacteria | 25736 |
| 63 | Ga0072941_1055316 | 3300005201 | Bacteria | 6809 |
| 64 | Ga0466720_103069 | 3300042607 | Bacteria | 23488 |
| 65 | Ga0466735_055264 | 3300042624 | Bacteria | 1879 |
| 66 | Ga0466703_029565 | 3300042636 | Bacteria | 8863 |
| 67 | Ga0466704_026191 | 3300042643 | Bacteria | 7853 |
| 68 | Ga0466709_373281 | 3300042648 | Unclassified | 2474 |
| 69 | Ga0466708_111105 | 3300042652 | Bacteria | 10055 |
| 70 | Ga0466727_237004 | 3300042655 | Bacteria | 2600 |
| 71 | Ga0466727_275885 | 3300042655 | Bacteria | 2270 |
| 72 | Ga0466705_505797 | 3300042612 | Bacteria | 7993 |
| 73 | Ga0466712_066014 | 3300042614 | Bacteria | 17562 |
| 74 | Ga0466712_206728 | 3300042614 | Bacteria | 5390 |
| 75 | Ga0466715_099453 | 3300042616 | Bacteria | 12250 |
| 76 | Ga0466723_173837 | 3300042618 | Bacteria | 38157 |
| 77 | Ga0466723_181433 | 3300042618 | Bacteria | 3080 |
| 78 | Ga0466726_064831 | 3300042619 | Bacteria | 1577 |
| 79 | Ga0466726_159305 | 3300042619 | Bacteria | 11235 |
| 80 | Ga0466726_168811 | 3300042619 | Bacteria | 6806 |
| 81 | Ga0466690_258385 | 3300042590 | Bacteria | 24406 |
| 82 | JGI24698J34947_10002528 | 3300002449 | Bacteria | 9870 |
| 83 | Ga0072941_1013467 | 3300005201 | Bacteria | 41607 |
| 84 | Ga0072941_1055314 | 3300005201 | Unclassified | 4377 |
| 85 | Ga0072941_1055315 | 3300005201 | Bacteria | 4416 |
| 86 | Ga0466716_007985 | 3300042605 | Bacteria | 13976 |
| 87 | Ga0466716_106595 | 3300042605 | Bacteria | 10774 |
| 88 | Ga0466719_158535 | 3300042606 | Bacteria | 3373 |
| 89 | Ga0466720_144451 | 3300042607 | Bacteria | 13914 |
| 90 | Ga0466722_073815 | 3300042609 | Bacteria | 1786 |
| 91 | Ga0466703_234239 | 3300042636 | Bacteria | 2831 |
| 92 | Ga0466709_166264 | 3300042648 | Bacteria | 7090 |
| 93 | Ga0466708_187514 | 3300042652 | Bacteria | 17335 |
| 94 | Ga0466708_327929 | 3300042652 | Bacteria | 10419 |
| 95 | Ga0466708_413668 | 3300042652 | Bacteria | 4654 |
| 96 | Ga0466711_007434 | 3300042615 | Bacteria | 2358 |
| 97 | Ga0466711_227574 | 3300042615 | Bacteria | 3280 |
| 98 | Ga0466715_123628 | 3300042616 | Bacteria | 15691 |
| 99 | Ga0466715_604767 | 3300042616 | Bacteria | 2920 |
| 100 | Ga0466718_026665 | 3300042617 | Bacteria | 2027 |
| 101 | Ga0466723_132381 | 3300042618 | Bacteria | 19549 |
| 102 | Ga0466723_298681 | 3300042618 | Bacteria | 7905 |
| 103 | Ga0466726_406804 | 3300042619 | Bacteria | 2441 |
| 104 | Ga0466728_301630 | 3300042620 | Unclassified | 3649 |
| 105 | Ga0466692_127000 | 3300042591 | Bacteria | 4741 |
| 106 | Ga0466692_191152 | 3300042591 | Bacteria | 22289 |
| 107 | Ga0466691_017858 | 3300042593 | Bacteria | 40250 |
| 108 | Ga0466696_091449 | 3300042596 | Bacteria | 26973 |
| 109 | AustNasuHG_c1012641 | 3300000089 | Bacteria | 2912 |
| 110 | Ga0074263_109212 | 3300005485 | Bacteria | 3830 |
| 111 | Ga0466707_183074 | 3300042601 | Bacteria | 1814 |
| 112 | Ga0466716_482924 | 3300042605 | Bacteria | 6576 |
| 113 | Ga0466719_370630 | 3300042606 | Unclassified | 2110 |
| 114 | Ga0466720_026962 | 3300042607 | Bacteria | 21556 |
| 115 | Ga0466720_210120 | 3300042607 | Bacteria | 2687 |
| 116 | Ga0466735_068642 | 3300042624 | Bacteria | 19652 |
| 117 | Ga0466703_144890 | 3300042636 | Bacteria | 8156 |
| 118 | Ga0466704_151912 | 3300042643 | Bacteria | 3646 |
| 119 | Ga0466704_314205 | 3300042643 | Bacteria | 42787 |
| 120 | Ga0466709_199873 | 3300042648 | Bacteria | 7372 |
| 121 | Ga0466727_237112 | 3300042655 | Bacteria | 2284 |
| 122 | Ga0466718_046988 | 3300042617 | Bacteria | 6336 |
| 123 | Ga0466726_369912 | 3300042619 | Bacteria | 4806 |
| 124 | Ga0466690_010624 | 3300042590 | Bacteria | 4461 |
| 125 | Ga0466690_310364 | 3300042590 | Bacteria | 2338 |
| 126 | Ga0466691_048038 | 3300042593 | Bacteria | 1874 |
| 127 | Ga0466691_084454 | 3300042593 | Bacteria | 38843 |
| 128 | Ga0466696_171413 | 3300042596 | Bacteria | 3424 |
| 129 | Ga0466705_253624 | 3300042612 | Bacteria | 5971 |
| 130 | Ga0074263_112073 | 3300005485 | Bacteria | 2101 |
| 131 | Ga0466716_066306 | 3300042605 | Bacteria | 15563 |
| 132 | Ga0466719_142056 | 3300042606 | Bacteria | 3217 |
| 133 | Ga0466719_235447 | 3300042606 | Bacteria | 9954 |
| 134 | Ga0466720_237359 | 3300042607 | Bacteria | 10851 |
| 135 | Ga0466735_138758 | 3300042624 | Bacteria | 5058 |
| 136 | Ga0466703_268972 | 3300042636 | Bacteria | 4230 |
| 137 | Ga0466709_012184 | 3300042648 | Bacteria | 20533 |
| 138 | Ga0466727_222594 | 3300042655 | Bacteria | 1899 |
| 139 | Ga0466712_052747 | 3300042614 | Bacteria | 2033 |
| 140 | Ga0466712_113361 | 3300042614 | Bacteria | 28866 |
| 141 | Ga0466715_474234 | 3300042616 | Bacteria | 8120 |
| 142 | Ga0466718_114622 | 3300042617 | Bacteria | 2330 |
| 143 | Ga0466723_166418 | 3300042618 | Bacteria | 2302 |
| 144 | Ga0466723_286404 | 3300042618 | Bacteria | 4301 |
| 145 | Ga0466690_391133 | 3300042590 | Bacteria | 7244 |
| 146 | Ga0466692_193868 | 3300042591 | Bacteria | 2269 |
| 147 | Ga0466691_054722 | 3300042593 | Bacteria | 6498 |
| 148 | Ga0466691_125258 | 3300042593 | Bacteria | 7731 |
| 149 | Ga0466696_110208 | 3300042596 | Bacteria | 6762 |
| 150 | Ga0466696_198185 | 3300042596 | Bacteria | 2962 |
| 151 | Ga0466705_032803 | 3300042612 | Bacteria | 6258 |
| 152 | JGI24698J34947_10048079 | 3300002449 | Bacteria | 2162 |
| 153 | Ga0466719_178432 | 3300042606 | Bacteria | 37138 |
| 154 | Ga0466720_044830 | 3300042607 | Unclassified | 2279 |
| 155 | Ga0466720_067758 | 3300042607 | Bacteria | 23423 |
| 156 | Ga0466703_021597 | 3300042636 | Bacteria | 8927 |
| 157 | Ga0466708_013117 | 3300042652 | Bacteria | 25821 |
| 158 | Ga0466727_228522 | 3300042655 | Bacteria | 2128 |
| 159 | Ga0466712_074660 | 3300042614 | Bacteria | 8893 |
| 160 | Ga0466712_260243 | 3300042614 | Unclassified | 2225 |
| 161 | Ga0466711_040856 | 3300042615 | Bacteria | 16674 |
| 162 | Ga0466711_285721 | 3300042615 | Bacteria | 8161 |
| 163 | Ga0466715_119326 | 3300042616 | Bacteria | 9486 |
| 164 | Ga0466723_012039 | 3300042618 | Bacteria | 3871 |
| 165 | Ga0466723_021632 | 3300042618 | Bacteria | 6177 |
| 166 | Ga0466726_033408 | 3300042619 | Bacteria | 25334 |
| 167 | Ga0466728_254846 | 3300042620 | Bacteria | 3878 |
| 168 | Ga0466728_437956 | 3300042620 | Bacteria | 21766 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00330 | Aconitase | Aconitase family (aconitate hydratase) | 304 | 419 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.